SecReT6
Effector Protein ID: 423049860
-
SecReT6 ID778
T6SS typeB
Gene symbol-
Locus tagF92_00645
StrainFrancisella tularensis subsp. holarctica F92
Repliconchromosome [GenBank: NC_019537] [Browse all T6SS(s) in this replicon]
Location [Strand]111900..113051 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTL_0118
DescriptionIglI protein
UniProt IDK7WY30
KEGG IDfts:F92_06430, fts:F92_00645
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 383 a.a.     [Download]
>gi|423049860|ref|YP_007008294.1| hypothetical protein F92_00645 [Francisella tularensis subsp. holarctica F92]
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNL
DTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIE
IVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKW
KTLIEKIEVLKALVESERMFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSS
IQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIV
IKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI
-
Nucleotide Sequence: 1152 bp     [Download]
>gi|423049750|ref|NC_019537.1|:c113051-111900 Francisella tularensis subsp. holarctica F92 chromosome, complete genome
ATGAGTCAGATAATATCTACACTAAATAATATTGATTTAGTAACTCAAGATAAAGTAAATCTGATTAGTA
ATATGCAAATACAAGCAAAATATGAAAACGCTGAGTATAAGTCATTTATTGATCAATTAATAGATAATCT
TAATACTACTAGAAGCATAGATATATATAACTTATTTCTATCTTTAAATTCAGAAATATGCCTCAATTTA
GATACGGTTGATAATATCTCTAAAATTATTAGCTCTTATTTATCTATTCTAAATACTAATTTCACAAGAA
TTAGTCCATCAGAATCAAAGCAAAAAAACCAGCTAGCTGAAAAAGGAATAAACAAATTCTTAGTCACTAT
GGATGCAAATTTTGCGCAAATGCAGAATCAAGACAAGTTGTTACCAAATAACATAGATTCTATTATAGAA
ATTGTACAGGAAGTAATAATATTTTTTGAGAAAAATAACTTAAATTATAATTCTGATTTTAAAATCCAAC
TAAATAAGACTCTCAGAAAAATAAAAAGTTCTTTGATTTTAAAAGATCAAAAAAATGATACGTATTCCGA
TAAAGAATCAATAAATCAAGTTGAAGCAACTATCACAGATCAAAAAACCATACAAGGCTCTGAGAAATGG
AAAACTCTTATTGAAAAAATTGAAGTTTTAAAAGCTCTAGTTGAAAGTGAAAGAATGTTTGAAACATCTA
TTGTTTATAATGATATACAAAACTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCCAGAAATTTTCTT
TCCATTATACAAGAAGATAGCTCCTTTTATTGGCAATATCCATAAAAACATAGACTACTACTCATCAAGT
ATTCAGTGGAGTATAGCTCAGAAGATGTACAACATAGATTATAAGAGTTTTCTAGATACTCTTGAGAAAA
TGCCCGAAAATAATTTTTTAAATTCTTCTTCTGATATAACTAAAAATTTCTTTTATGAAACATCCTCAGA
GGTGGAAAAAACTCCTATCGAAGAACATAAAATAATTGCAGATACAGATGCTATCAAAGAAGAAATAGTA
ATAAAACAGCGAACCAATAATAAAAAAAACCAGAATGACCCCGTAGAAAAAATTTCAAATAAAATAGATG
AAGACTATTTTGAAGATCTTTTTGACATATAA