SecReT6
Effector Protein ID: 431929284
-
SecReT6 ID718
T6SS typeN/A
Gene symbol-
Locus tagPsest_4218
StrainPseudomonas stutzeri RCH2
Repliconchromosome [GenBank: NC_019936] [Browse all T6SS(s) in this replicon]
Location [Strand]4397058..4397576 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDL0GPL1
KEGG IDpsh:Psest_4218
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.20E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|431929284|ref|YP_007242318.1| type VI secretion system effector [Pseudomonas stutzeri RCH2]
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFQHQVIIPRDPQSGQPTGQRVHKPLMI
TKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVIVDVQSRMPNCQDPNMSHFTH
LEDVYFTYRKIVWTHEVSGTSGSDDWRTPIAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|431925209|ref|NC_019936.1|:c4397576-4397058 Pseudomonas stutzeri RCH2 chromosome, complete genome
ATGCCAACACCCGCGTATCTGTCCCTCGAAGGCACCAAGCAAGGCCTGATCACCGCCGGCACCTTCACCG
AGGACTCGGTTGGCAACATCTTCCAGGAAGGCCATGAGGACCAGATCCTGGTGCAGGCCTTCCAGCATCA
GGTCATCATTCCGCGTGACCCGCAGTCTGGCCAGCCGACAGGCCAGCGCGTGCACAAGCCACTGATGATT
ACCAAGGTGTTCGACAAGTCGTCGCCGCTGATCTTCAACGCCCTGACTTCCGGCGAGCGCCTGAACAAGT
GCCGTCTGGAGTGGTACCGCACCTCGTCCACCGGCACCCAGGAACACTACTTCACCATCGAGCTGGAAGA
TGCGGTGATCGTCGACGTGCAGTCGCGCATGCCCAACTGCCAGGACCCGAACATGTCCCACTTCACCCAT
CTGGAAGACGTGTACTTCACCTACCGCAAGATCGTTTGGACCCACGAGGTTTCCGGCACCTCCGGCTCCG
ACGACTGGCGCACCCCTATCGCCGGCTGA