SecReT6
Effector Protein ID: 440231424
-
SecReT6 ID724
T6SS typeA3
Gene symbol-
Locus tagD781_2781
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2930631..2931113 [+]
Producttype VI secretion system effector, Hcp1 family
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDL0MIA5
KEGG IDsmaf:D781_2781
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|440231424|ref|YP_007345217.1| type VI secretion system effector, Hcp1 family [Serratia marcescens FGI94]
MAIDMFLKVEGASGESKDSNHKGWTDITSFSWGASQPGNMSVGGGGGAGKVCFNDLHVNALVDKSTPALL
KHCSSGKHLTKIELSVCKAGGTQVEYVKITLDDVLVTAVQYTGSGGEDTVGVTYSFQAAKVKQQYWEQSD
KGGKGAESSAGWNIKENREA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2930631-2931113 Serratia marcescens FGI94, complete genome
ATGGCTATTGATATGTTCCTGAAAGTTGAAGGCGCCAGCGGTGAATCTAAAGATTCCAACCACAAAGGCT
GGACCGACATCACTTCTTTCTCCTGGGGCGCGTCCCAGCCGGGCAACATGAGCGTGGGCGGCGGCGGCGG
TGCCGGTAAAGTGTGCTTTAACGACCTGCACGTTAACGCGCTGGTTGATAAATCCACCCCGGCTCTGCTG
AAGCACTGCTCCAGCGGTAAGCACCTGACCAAAATCGAACTGTCCGTCTGTAAAGCCGGCGGTACTCAGG
TTGAGTATGTAAAAATCACCCTGGACGACGTACTGGTTACCGCTGTGCAGTACACCGGTTCAGGCGGTGA
AGACACCGTTGGCGTAACCTACTCCTTCCAGGCTGCTAAAGTTAAACAGCAGTACTGGGAGCAGAGCGAT
AAAGGTGGTAAAGGCGCAGAAAGCAGCGCAGGTTGGAACATCAAAGAAAACCGCGAAGCTTAA