SecReT6
Effector Protein ID: 444351406
SecReT6 ID727
T6SS typeA3
Gene symbol-
Locus tagST548_p7048
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1265899..1266381 [+]
ProductUncharacterized protein ImpD
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDL8BDS5
KEGG IDear:ST548_p7048
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|444351406|ref|YP_007387550.1| Uncharacterized protein ImpD [Enterobacter aerogenes EA1509E]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCSSGKHLTKVELSVCKAGGQQVEYARITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTS
AGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1265899-1266381 Enterobacter aerogenes EA1509E, complete genome
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTAACCGGTGAATCAAAAGATTCTAATCACACCGGTT
GGACTGATATTACCTCTTTTTCCTGGGGCGCATCCCAGCCGGGTAATATGAGCGTGGGCGGCGGTGGCGG
TGCGGGTAAAGTGAATTTCAACGACCTGCACGTAAATGCGCTGATCGACAAATCCACCACCGCGATTCTG
AAGCACTGCTCCAGCGGCAAGCACCTGACCAAAGTTGAACTTTCGGTCTGCAAAGCCGGTGGTCAGCAGG
TTGAATATGCGCGAATCACCCTCGAAGATGTACTGGTGACTTCCGTTCAGTACACCGGCGCCGATAACGG
CGACACTGTTGGCGTAACCTATGCCTTCCAGGCGGCGAAAGTGAAACAGCAGTACTGGGAGCAGACTTCC
GCTGGCGGTAAAGGGGCAGAAAGCAGCGCCGGCTGGAATATCAAAGAAAATAAAGAAGCATAA