SecReT6
Effector Protein ID: 444354730
SecReT6 ID727
T6SS typeA3
Gene symbol-
Locus tagST548_p3724
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]4705843..4706325 [+]
ProductUncharacterized protein ImpD
Effector typeProtein
Homologous effectorSMA3455
DescriptionHcp protein
UniProt IDL8BMY4
KEGG IDear:ST548_p3724
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-37, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|444354730|ref|YP_007390874.1| Uncharacterized protein ImpD [Enterobacter aerogenes EA1509E]
MAIDMYLKVDGVTGESNDSNHKNWIDVLSFSWAAEQPGNMSVGGGGGAGKVNFQDLSVQALIDKATPAVL
KFCASGKHVAKVELSICKAGGSQIEYSRVVLEDVLVTKTSFSGVGHTDTIMVNYLFQASKVNLHYWEQSS
QGTKGAETKSGWDIKQNKEI
-
Nucleotide Sequence: 483 bp     [Download]
>gi|444350194|ref|NC_020181.1|:4705843-4706325 Enterobacter aerogenes EA1509E, complete genome
ATGGCTATTGATATGTATCTGAAGGTTGATGGGGTAACCGGTGAATCTAACGACTCAAATCATAAAAATT
GGATAGATGTTTTGTCATTTAGCTGGGCGGCTGAGCAGCCTGGGAATATGAGCGTTGGCGGCGGTGGCGG
AGCGGGTAAAGTTAATTTTCAGGACCTTTCGGTACAAGCATTGATAGATAAAGCAACGCCGGCAGTTCTC
AAGTTTTGCGCTAGCGGTAAACATGTCGCTAAAGTCGAACTATCAATTTGCAAAGCCGGCGGCTCGCAAA
TTGAGTATTCGCGTGTTGTTCTTGAAGATGTTCTGGTGACGAAAACCAGTTTTAGCGGTGTGGGTCATAC
CGACACTATTATGGTGAATTACCTGTTTCAGGCATCTAAAGTTAATCTGCATTATTGGGAGCAGTCTTCT
CAAGGGACCAAAGGCGCAGAAACTAAATCGGGTTGGGATATCAAACAGAATAAAGAAATTTAA