SecReT6
Effector Protein ID: 447916354
-
SecReT6 ID728
T6SS typeA1
Gene symbol-
Locus tagH045_06770
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1469411..1469926 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDM4JZ03
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-38, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|447916354|ref|YP_007396922.1| hypothetical protein H045_06770 [Pseudomonas poae RE*1-1-14]
MPTPAYLSITGVKQGLITAGTFTQDSVGNIYQEGHEDQILVQAFAHQVIIPRDPQSGQPTGQRVHKPLMI
SKVFDKSSPLLFSALTSGEEVKCRLEWLRTSSAGTQEHYFTIELEGATIVDIQSRMPNCQDPDNAHFTHL
EDVYFTYRKIVWTHEVSGTSGSDDWRSPVSS
-
Nucleotide Sequence: 516 bp     [Download]
>gi|447915004|ref|NC_020209.1|:c1469926-1469411 Pseudomonas poae RE*1-1-14, complete genome
ATGCCAACACCCGCGTATCTCTCCATCACTGGCGTCAAGCAAGGTTTGATTACGGCAGGCACTTTTACTC
AGGACTCGGTAGGCAATATTTACCAGGAAGGGCACGAGGACCAGATTCTCGTCCAGGCGTTTGCGCACCA
GGTCATCATCCCGCGCGATCCGCAATCCGGTCAGCCAACCGGACAGCGGGTGCACAAGCCGTTGATGATC
AGCAAGGTGTTCGACAAGTCATCGCCCCTGCTCTTCAGCGCACTCACCAGCGGTGAGGAGGTGAAGTGCC
GGCTGGAGTGGCTGCGCACTTCATCGGCCGGCACCCAGGAGCATTACTTCACCATCGAACTCGAGGGGGC
GACCATCGTCGATATCCAGTCGCGCATGCCCAATTGCCAGGACCCGGACAACGCGCACTTCACCCATCTG
GAAGACGTGTATTTCACGTATCGCAAGATTGTCTGGACCCACGAAGTGTCTGGCACTTCGGGCTCGGACG
ATTGGCGCAGCCCGGTGTCCAGCTGA