SecReT6
Effector Protein ID: 448242776
-
SecReT6 ID730
T6SS typeA3
Gene symbol-
Locus tagSMWW4_v1c30160
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3255297..3255779 [+]
Producttype VI secretion system secreted protein Hcp
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDL7ZMD4
KEGG IDsmw:SMWW4_v1c30160
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.20E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|448242776|ref|YP_007406829.1| type VI secretion system secreted protein Hcp [Serratia marcescens WW4]
MAIDMFLKVEGASGESKDSNHKGWTDITSFSWGASQPGNMGVGGGGGAGKVCFNDLHVNALIDKSTPALL
KHCSSGKHLTKIELSVCKAGGTQVEYAKITLEDVLVTAVQYTGAGGEDTVGVTYSFQAAKVKQQYWEQSD
KGGKGAESSAGWNIKENREA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3255297-3255779 Serratia marcescens WW4, complete genome
ATGGCTATTGATATGTTCCTGAAAGTTGAAGGTGCCAGCGGCGAATCCAAAGATTCGAATCACAAAGGCT
GGACCGACATTACTTCTTTCTCCTGGGGCGCTTCTCAACCGGGCAATATGGGCGTTGGCGGCGGCGGTGG
CGCCGGTAAAGTGTGCTTCAACGATCTGCACGTCAACGCGCTGATCGACAAGTCAACCCCGGCCTTGCTG
AAACACTGCTCAAGCGGCAAACACCTGACCAAGATTGAGCTGTCGGTTTGCAAGGCGGGCGGCACCCAGG
TTGAATACGCAAAAATCACTCTGGAAGACGTGCTGGTCACCGCCGTGCAGTACACCGGTGCAGGCGGCGA
AGACACCGTGGGCGTCACCTACTCCTTCCAGGCGGCGAAAGTGAAACAGCAGTACTGGGAGCAGAGCGAC
AAAGGCGGCAAAGGCGCCGAAAGCAGCGCAGGTTGGAACATCAAGGAAAACCGCGAAGCTTAA