SecReT6
Effector Protein ID: 448242918
-
SecReT6 ID731
T6SS typeA3
Gene symbol-
Locus tagSMWW4_v1c31580
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3406611..3407135 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorYPK_3563
DescriptionHcp protein
UniProt IDL7ZPB0
KEGG IDsmw:SMWW4_v1c31580
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-32, Aligned region: 10..150
Protein Sequence: 174 a.a.     [Download]
>gi|448242918|ref|YP_007406971.1| hypothetical protein SMWW4_v1c31580 [Serratia marcescens WW4]
MSTKALVDYFLKIEGVDGESPDQTYPGWIQLQAWQWAEENAGRWGFGSGGGSGKVEMKDFEFRMVSNKAS
PKLFLMCATGEHIPQAKLVCRKSGQGQQDFIAVTFSNCLVSSFKTVGNMPLNSTIGTEIDTVLPTDVIKL
NFARIEVEYKEQNNDGSMGAVIKTGYDLKLNARI
-
Nucleotide Sequence: 525 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3407135-3406611 Serratia marcescens WW4, complete genome
ATGAGCACGAAAGCTTTAGTAGACTATTTTTTGAAAATTGAGGGTGTTGATGGTGAATCACCCGACCAAA
CCTACCCTGGCTGGATTCAGCTGCAAGCCTGGCAATGGGCGGAAGAAAACGCCGGCCGTTGGGGGTTCGG
GAGCGGCGGCGGTTCAGGCAAAGTCGAGATGAAAGACTTTGAGTTTCGCATGGTGAGCAACAAGGCTTCG
CCGAAACTGTTCCTGATGTGCGCCACCGGCGAGCATATTCCTCAGGCAAAACTTGTTTGCCGTAAATCAG
GCCAGGGTCAGCAAGACTTCATTGCCGTGACCTTCAGCAACTGCCTGGTTTCCTCATTCAAGACCGTGGG
TAATATGCCGCTGAATTCCACCATCGGTACTGAAATCGATACCGTGCTGCCAACCGACGTTATCAAGCTG
AATTTCGCACGTATCGAAGTTGAGTACAAAGAGCAAAACAATGATGGCTCCATGGGTGCGGTAATTAAGA
CGGGGTATGACCTCAAGCTTAATGCCCGTATCTGA