SecReT6
Effector Protein ID: 448243903
-
SecReT6 ID731
T6SS typeA3
Gene symbol-
Locus tagSMWW4_v1c41500
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]4491462..4491944 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorSMA3456
DescriptionHcp protein
UniProt IDL7ZS66
KEGG IDsmw:SMWW4_v1c41500
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|448243903|ref|YP_007407956.1| type VI secretion system effector [Serratia marcescens WW4]
MAMDMFLKVEGINGESKNANHKQWIDVFSFNWGARQPGNMAVGGGGGTGKVNFRDLTVQALIDKATPALL
KYCSAGKHLAKVQLSLCKAGGQEVEYTRITLEDVLVTHTDFIGVEHGSTLGIEYSFQAGKVSMEYWEQAK
QGNKGASVQMGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|448239774|ref|NC_020211.1|:4491462-4491944 Serratia marcescens WW4, complete genome
ATGGCAATGGATATGTTTTTAAAAGTTGAAGGCATTAATGGCGAATCGAAAAATGCGAATCACAAGCAAT
GGATCGATGTCTTTTCCTTTAACTGGGGCGCGCGGCAGCCTGGCAATATGGCCGTTGGCGGCGGCGGCGG
TACGGGTAAAGTGAATTTTCGCGATCTGACCGTACAGGCTCTGATAGATAAAGCGACACCTGCCTTATTG
AAATACTGTTCGGCCGGTAAACACCTCGCCAAGGTGCAGTTGTCGCTTTGCAAAGCCGGTGGGCAGGAAG
TGGAATATACCCGCATTACTCTGGAAGATGTATTAGTGACTCATACCGACTTCATCGGTGTCGAGCACGG
TTCCACGCTAGGCATTGAATACTCTTTTCAGGCCGGTAAAGTATCGATGGAATACTGGGAGCAAGCGAAG
CAAGGCAATAAAGGAGCTTCGGTGCAGATGGGCTGGGACATTAAGCAAAATAAAGAAAGCTAA