SecReT6
Effector Protein ID: 448244442
-
SecReT6 ID731
T6SS typeA3
Gene symbol-
Locus tagSMWW4_v1c46890
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]5079351..5080346 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA3980
DescriptionSsp4
UniProt IDL7ZUS5
KEGG IDsmw:SMWW4_v1c46890
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 331 a.a.     [Download]
>gi|448244442|ref|YP_007408495.1| hypothetical protein SMWW4_v1c46890 [Serratia marcescens WW4]
MKTAFSTPFGSPEDDLTNAEFARLLGNAGVQEFYRDINLQALQDSLDCSLAFHGVGIIFSDGQNSFLVRP
TQHTGYSNASQVTHVVISKTVAHTSRVAATNTLSEALSKPSVSKELASAALSCGTLLVSVFLLASGSVAV
PFTGGTSSAVAYLGYAGMAASALQCGNGLYRVNKLYDGKGDELAQLDSEQWYIATSTVLDVISLASAGAA
LKEATMTYRAMRRISARKATEWLKSMPRSERKRLTENIIRAENPGISNNVLKEMVKNGLYPKRYPTEAIQ
NGLRQQLHSALNNALTFVGSGISGTLSAPVNVKTTGQYFVGIMQKLPQMVR
-
Nucleotide Sequence: 996 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c5080346-5079351 Serratia marcescens WW4, complete genome
ATGAAAACCGCTTTTTCTACGCCGTTCGGTTCTCCCGAAGACGATTTGACCAACGCCGAATTTGCCCGCC
TGTTGGGCAATGCCGGGGTACAAGAATTCTATCGCGATATTAATCTGCAAGCCTTGCAGGACTCGCTGGA
CTGCAGCCTCGCTTTTCATGGCGTGGGAATTATTTTTTCCGACGGGCAAAACTCATTTTTAGTCCGCCCG
ACGCAGCACACCGGTTATTCGAACGCTTCGCAGGTCACGCACGTGGTCATCAGCAAAACGGTGGCTCATA
CCTCGCGCGTTGCCGCGACCAATACGCTGTCGGAAGCGTTGAGCAAACCCAGCGTCAGCAAAGAGTTGGC
CTCGGCCGCGCTGTCGTGCGGAACGCTGCTGGTATCGGTATTTTTACTGGCGTCGGGCAGCGTCGCCGTG
CCGTTCACCGGCGGCACCAGCTCTGCGGTGGCTTATCTGGGCTATGCCGGCATGGCCGCCAGCGCGCTGC
AGTGCGGCAATGGGCTATACCGTGTCAACAAGCTGTATGACGGGAAAGGCGATGAATTGGCGCAGCTCGA
CTCTGAGCAGTGGTATATCGCCACCAGCACCGTACTCGATGTGATCTCGCTGGCCAGCGCGGGAGCCGCC
CTGAAGGAAGCGACGATGACCTACCGCGCCATGCGCCGCATTTCGGCGCGCAAGGCGACGGAATGGCTGA
AAAGCATGCCCCGCAGCGAAAGGAAGCGGCTGACCGAAAACATCATTCGAGCGGAAAATCCGGGGATTTC
CAATAACGTCTTGAAAGAAATGGTGAAGAACGGCTTATACCCGAAGCGTTACCCGACGGAAGCGATCCAA
AACGGGCTGCGTCAGCAATTGCATTCGGCGCTCAATAACGCGTTAACGTTCGTGGGCAGCGGCATCAGCG
GCACCCTGTCTGCGCCGGTGAATGTGAAAACCACCGGGCAGTATTTTGTGGGCATTATGCAGAAATTGCC
GCAGATGGTGAGGTAA