SecReT6
Effector Protein ID: 449306477
-
SecReT6 ID734
T6SS typeN/A
Gene symbol-
Locus tagCSSP291_20748
StrainCronobacter sakazakii Sp291
Repliconplasmid pSP291-1 [GenBank: NC_020263] [Browse all T6SS(s) in this replicon]
Location [Strand]43539..44021 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDM1JQ70
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-35, Aligned region: 6..135
Candida_ALS [PF05792], Evalue: 0.0068, Aligned region: 102..122
Protein Sequence: 160 a.a.     [Download]
>gi|449306477|ref|YP_007443017.1| hypothetical protein CSSP291_20748 [Cronobacter sakazakii SP291]
MAIDMFLKVEGVTGESKDANHASWIDVLSFNWGAAQPGNMAVGGGGGAGKVNFQDLAVQAIVDKGTPAVL
KFCASGKHVNKVELSVCKAGGQQVEYSKIVLEDVLVTRTEFTGVGQTDTVLVSYYFQAAKVNFHYWEQSN
QGTKGAETKAGWDIKQNKEL
-
Nucleotide Sequence: 483 bp     [Download]
>gi|449306428|ref|NC_020263.1|:43539-44021 Cronobacter sakazakii Sp291 plasmid pSP291-1, complete sequence
ATGGCTATTGATATGTTCCTGAAAGTGGAAGGCGTGACTGGCGAATCTAAAGATGCTAATCATGCCAGCT
GGATTGATGTTCTTTCTTTTAACTGGGGCGCAGCGCAGCCGGGCAATATGGCGGTCGGCGGTGGTGGCGG
TGCCGGTAAAGTTAACTTTCAGGATTTAGCCGTTCAGGCCATTGTGGATAAAGGCACCCCTGCGGTTCTT
AAATTCTGCGCCAGCGGTAAACACGTGAATAAAGTTGAGCTTTCTGTCTGTAAAGCCGGTGGTCAGCAGG
TAGAATATTCAAAAATCGTTCTTGAAGATGTGCTGGTGACCCGCACGGAATTCACGGGCGTTGGGCAGAC
AGATACGGTTCTTGTCAGTTACTACTTCCAGGCCGCGAAGGTGAATTTCCATTACTGGGAACAGTCGAAC
CAGGGTACCAAAGGTGCGGAAACCAAAGCCGGTTGGGATATTAAACAAAATAAAGAGCTCTGA