SecReT6
Effector Protein ID: 470152649
-
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_0140
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]164882..166729 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDK4FIK1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-67, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.70E-22, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 0.00021, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 0.00021, Aligned region: 516..536
Gp5_C [PF06715], Evalue: 0.00021, Aligned region: 604..611
Protein Sequence: 615 a.a.     [Download]
>gi|470152649|ref|YP_006281151.1| VgrG protein [Pectobacterium sp. SCC3193]
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQSFSLSLNLASALPDVDFGAVLDQPCELLIWFEGELK
RRVSGIISGFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEEAGITDYAFSLRHD
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGEYV
HRFRYAERVSIAEVALKDYSFKTPAYGLLHKKMSSELAHQRESYQHFDYPGRFKKDPSGKAFSRYRLDAL
RAGAMTGAGDSNAAMLMPGNSFMLTEHPNLPLNTGWQVVAITHSGQQPQALEEESGGEPTTYSNSFEVIS
AKTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTSTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRSTTVTADHTESVGGNQTVSVEKDQHTEIQGEQAIAIIGSRSTVIGKDGKG
KSHDSLQVKNNIAIQSQKGDILIATNGGFIGISAEGDITIKGKTITVNGSRIDLN
-
Nucleotide Sequence: 1848 bp     [Download]
>gi|470152509|ref|NC_017845.1|:164882-166729 Pectobacterium sp. SCC3193, complete genome
ATGGCCAACAGTACAGGATTGCAGTTCACCGTAAAGGTCGGCGCCTTGCCGGCCTCGACGTTTGCGGTGG
TGGATTTTCAGCTCAGCGAGGCGCTTAACCAGTCGTTTTCCCTGTCCCTCAATCTGGCCAGCGCCCTGCC
GGATGTGGATTTTGGCGCGGTGCTGGACCAGCCCTGTGAGCTGCTGATTTGGTTCGAAGGCGAGTTGAAG
CGACGGGTGAGCGGGATAATCAGCGGCTTTGCCCAGGGTGACACCGGCTTTCGCCGCACCCGCTATCAGG
CGGAAGTGCGTCCGGCGTTGTGGCGACTCGGCTTACGCACCAACGCCCGCATTTTTCAGGCGCAGAAGCC
AGAGGCGATTATCGGCACCCTGCTGGAAGAAGCCGGGATTACCGACTACGCCTTCTCGTTACGTCATGAC
CATGCCCCGCGTGAATACTGCGTGCAGTACCGGGAAAGTGATTTGGCGTTTGTCACCCGACTGGCCGCCG
AGGAAGGCTTGTACTTCTTCCACGAGTTTGAGGAAGGCAAACACCGGGTGGTCTTTGCCGACGATGCCGG
CGCACTGGCCAAAGGCCCTGAACTGTTCTTCAACCTCGCCACGCAGGGGCTGAGTGAAGGCGAATATGTC
CACCGTTTCCGCTACGCCGAGCGGGTCAGCATCGCCGAGGTGGCGCTCAAGGACTACAGCTTCAAAACCC
CGGCCTATGGCCTGCTGCACAAGAAGATGAGCAGCGAACTGGCACACCAGCGCGAAAGCTATCAGCACTT
TGACTACCCCGGACGCTTTAAAAAAGACCCGAGCGGCAAGGCGTTCAGCCGCTACCGGCTGGATGCACTG
CGTGCTGGGGCCATGACCGGCGCGGGGGACTCCAACGCCGCGATGCTGATGCCGGGCAACAGTTTCATGC
TCACCGAGCACCCCAACCTGCCCCTCAACACCGGCTGGCAAGTGGTTGCCATCACCCACAGCGGACAGCA
ACCGCAGGCGCTGGAGGAAGAAAGCGGCGGCGAACCGACCACCTACAGCAACAGCTTCGAGGTCATCAGC
GCCAAAACCACCTGGCGTGCCGACCTGCCGTACAAGCCGATGGTCGATGGCCCGCAGATTGCCACGGTGG
TGGGCCCGGCCGGTGAGGAAATCTACTGTGACGAATACGGCCGCATCAAGCTGCAATTCCCGTGGGACCG
CTACGGGGCGAGTGACGACCAGAGCTCCTGCTGGGTACGGGTGAGCCAGGGCTGGGCGGGCGGCCAGTAC
GGGCTGATAGCCATCCCGCGCATCGGCCATGAGGTGATTGTCAGCTTCCTCGAAGGCGACCCGGACCAGC
CGATAGTGACCGGCAGAACCTTTCATGCCACCAATCCGTCGCCGTACCCGCTGCCCGCCAACAAGACCCG
TACCTCACTGCGGACCTCAACGCACAAGGGAGCCGGGTTCAACGAGCTGCGCTTTGAAGACCAGGCCGGG
CAGGAGGAGGTATTTATCCATGCCCAGAAGGACATGAACACCGTGGTGCTCAATAACCGCAGCACCACCG
TGACCGCTGACCATACCGAAAGCGTCGGCGGCAATCAGACGGTGTCGGTGGAGAAAGACCAGCACACTGA
AATTCAGGGGGAGCAGGCTATCGCCATTATTGGCAGTCGCAGCACCGTCATCGGTAAAGACGGCAAGGGA
AAGTCGCACGACTCCCTGCAGGTGAAAAACAATATCGCCATCCAGTCACAAAAGGGCGACATCCTGATAG
CGACCAACGGCGGTTTTATCGGCATCAGTGCCGAAGGTGACATCACCATCAAAGGCAAAACCATTACCGT
CAACGGCAGCCGTATTGACCTGAACTGA