SecReT6
Effector Protein ID: 470152651
-
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_0142
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]167185..171471 [+]
ProductYD repeat protein
Effector typeProtein
Homologous effectorDda3937_02773
DescriptionRhsB
UniProt IDK4FI84
KEGG IDpec:W5S_0142
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 467..476
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 487..513
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 560..586
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 595..628
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 613..648
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 655..671
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 677..714
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 742..779
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 767..800
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 807..842
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 848..881
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 870..901
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 888..917
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 947..971
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 976..987
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 1007..1043
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 1045..1063
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 1070..1092
RHS_repeat [PF05593], Evalue: 3.00E-56, Aligned region: 1108..1136
PAAR_motif [PF05488], Evalue: 5.10E-14, Aligned region: 113..178
DUF4595 [PF15283], Evalue: 2.90E-07, Aligned region: 506..550
DUF4595 [PF15283], Evalue: 2.90E-07, Aligned region: 590..637
DUF4595 [PF15283], Evalue: 2.90E-07, Aligned region: 649..677
DUF4595 [PF15283], Evalue: 2.90E-07, Aligned region: 775..804
DUF4595 [PF15283], Evalue: 2.90E-07, Aligned region: 866..951
DUF4595 [PF15283], Evalue: 2.90E-07, Aligned region: 1076..1165
Protein Sequence: 1428 a.a.     [Download]
>gi|470152651|ref|YP_006281153.1| YD repeat protein [Pectobacterium sp. SCC3193]
MLDDILSRIARVGAMHAGNRPTLPPDLPEPGQGKPPTSPGKPIKHSSFLGALLGAVAGALVAAAVAAVAV
ALVGVTGGLAIALVGGLAALGAGSLISAVSGRVSAMVDSASPPSGQVDGGSKTVFVEGNPVSRAEIDAVK
CAKHNGPQLIAQGSETVFVEGYYAARVDDKAVCGATIKEGASTVFFGSGQASPLKVQEEFSGWQKALLIA
VEFLVPPSKGLFRGLGRLFTGKGLVGVLRGAKAAAKYLARVPGKTRCAATAFIHSKGLARFSHAKAAFKA
DPVYIASGEVIESRTDIELGQTIPLVFERTYRSGSPHTGLLGQGWHDSWSEVATVDRTDKGDIQVTLTLA
QGYDIDFTFGIGATVVYCAEYPEFKLVKRHSGFHLWHRDSQTWRAFTVKQDNRLLLSAITDNHHNRIDFL
RDPKGYLRKIRHGDGIELLLVWQGEFLSQIQRIDGGQKTVLAEYRQDERGRLVEADAAHAYHLFYDYDSH
HRLTRWHDNDQTWARYEYDHQGRCIYTTCADGYLTANFEYLADRVVMIDGLGQRHEYGFNDLYLMAWEKS
PLGHLTRYEYDDVGNLLREISPAGRAVEFAYLGDSGLVSTFTDGSGHAWHYAYDDHERLIGITDPLGRRW
VWQYDNNGNPLSLTGPDASEMRFAWNRYGLLTEVSDQNGHVQASLFYDHRQRLLSATDAEARTQQLRYDQ
QDRLTTWTRPDGATYRLGYRRASWRLPEQLIRPDEKEEKRQYDKHNNLLNYTDGNGAVWQQTYGPFDLLT
SRTDAEGRTWQYDYDKDSQQLIGVTAPDGNRWQWWLDADGRVIRERDMAGTETHYGYDEDGHCISVRNGE
GEIRHFLYDGRGLLIKETAPDDTLYYRYDAAGRLTDVTSTTSHVQLEYDERDRVVQEHNSGTAIRRHYQD
ASHTVTRSLHWEGEEDSAALTSTFCYRATGELHQVQLPDGAELTLTHDAAGREAIRHSPGGFIQRREYDT
MGWLTREMSGQTVDGRLQPVQTREYLYDSAGNLTGTRRNREAAGYRLDASGRVLSVLSGGAGRTVNTEEE
YRYTRSGLPQDATRLTDWQAGRLTQQDNTHYQYDKAGRLIRRQVVQPGYRPQVWHYRWDSRNQLRVVDTP
NGERWLYRYDPFGRRIGKRCDQTAEAIRYLWDGDQIAEVRHYRDNQLVSRRHWVHNGWELLVQQRQNADE
SWETDFVTSGHNGEPQAIFNQTGELRWQAPRANLWGQRYTENAEKYDPGLAFAGQYRDDESGLCYNRFRY
YDPNGGCYISPDPIGVLGGESNYGYVHNPVSWIDPKGLAGCNIVHRAVTPEQAASIRAGNGISRPTPYHR
TTPTQHVAGAPHSRDPWISTTRSQSTAEYFATHGGTQAANPIVKIDLSKIPSDKILDVSNAQKAAEHLQT
PFTRNVAAAHQEVLIFGEIPSEAIIGFL
-
Nucleotide Sequence: 4287 bp     [Download]
>gi|470152509|ref|NC_017845.1|:167185-171471 Pectobacterium sp. SCC3193, complete genome
ATGCTTGATGACATCCTCTCGCGCATTGCGCGGGTTGGCGCGATGCATGCGGGGAATCGCCCCACCCTGC
CACCCGATTTGCCTGAACCGGGGCAGGGTAAACCGCCGACCTCACCGGGCAAGCCTATCAAACACAGCAG
CTTTCTGGGGGCGTTGCTCGGTGCGGTGGCCGGGGCACTCGTGGCCGCCGCCGTCGCGGCGGTGGCCGTT
GCCCTGGTGGGCGTCACTGGCGGGCTGGCCATTGCTCTGGTTGGTGGGCTGGCGGCACTGGGTGCAGGGA
GTCTGATATCTGCCGTCAGTGGTCGGGTGTCGGCCATGGTCGACAGCGCTTCGCCGCCATCAGGGCAGGT
TGATGGCGGTTCGAAGACCGTTTTTGTTGAAGGCAATCCGGTCTCCCGTGCGGAAATCGATGCGGTGAAG
TGCGCTAAACACAATGGTCCGCAACTGATTGCGCAGGGCAGTGAAACGGTGTTTGTCGAGGGATACTATG
CCGCACGGGTGGACGACAAGGCCGTGTGCGGTGCGACCATCAAGGAAGGGGCCTCGACGGTGTTCTTTGG
CTCCGGGCAGGCCTCGCCCCTCAAGGTGCAGGAGGAGTTCAGCGGCTGGCAGAAAGCGTTACTGATTGCG
GTGGAGTTTCTGGTGCCGCCGAGCAAGGGACTATTCAGAGGATTGGGCCGGTTATTTACCGGAAAAGGGC
TTGTCGGGGTACTCCGGGGGGCTAAAGCGGCGGCTAAATATCTAGCCCGGGTACCCGGAAAAACCCGCTG
TGCGGCAACGGCATTTATTCACAGCAAAGGACTGGCCCGCTTTTCTCATGCCAAAGCGGCCTTCAAAGCC
GACCCGGTCTACATCGCCAGCGGCGAGGTGATTGAAAGCCGTACCGATATCGAACTGGGGCAGACCATTC
CTCTGGTATTTGAGCGCACCTATCGCTCCGGTAGCCCTCACACCGGCCTGCTGGGACAGGGCTGGCACGA
TAGCTGGAGTGAAGTGGCCACCGTTGACCGCACCGACAAGGGTGACATCCAGGTGACGCTCACGCTGGCG
CAGGGTTACGACATCGACTTCACCTTCGGGATAGGGGCAACGGTGGTGTACTGCGCCGAATACCCCGAAT
TCAAACTGGTGAAACGCCATAGCGGCTTTCATCTGTGGCACCGCGACAGCCAGACCTGGCGGGCGTTTAC
CGTCAAACAAGATAACCGACTGCTGCTGTCGGCGATAACCGACAACCACCATAACCGCATTGACTTTCTG
CGCGACCCCAAAGGCTACCTGCGCAAGATTAGGCACGGCGACGGCATCGAGCTGCTGCTGGTGTGGCAGG
GAGAATTTCTCAGCCAGATACAGCGTATCGACGGCGGGCAAAAAACCGTGCTGGCCGAATACCGGCAGGA
TGAACGGGGGCGACTGGTTGAGGCCGATGCGGCCCATGCCTATCACCTGTTCTACGACTACGACAGCCAT
CACCGCCTGACGCGCTGGCACGATAACGACCAGACCTGGGCGCGGTATGAATACGACCATCAGGGACGCT
GTATCTACACCACCTGTGCCGATGGCTACCTGACGGCGAATTTCGAGTACCTGGCTGACCGCGTGGTGAT
GATTGACGGGCTGGGACAGCGCCATGAATACGGCTTCAACGACCTGTACCTGATGGCGTGGGAAAAATCT
CCGCTCGGCCATCTCACCCGCTATGAGTATGACGATGTGGGCAACCTGCTGCGGGAAATTTCCCCGGCGG
GTCGGGCAGTGGAATTTGCCTATCTGGGCGACAGCGGGCTGGTCAGCACCTTTACCGACGGCAGCGGCCA
CGCGTGGCACTACGCCTATGACGACCACGAGCGACTTATCGGTATTACCGACCCGCTGGGGCGCCGTTGG
GTCTGGCAGTACGACAATAACGGCAACCCGCTGAGTCTGACCGGGCCGGATGCGAGCGAAATGCGGTTTG
CCTGGAACCGCTACGGCCTGCTGACCGAAGTGAGCGACCAGAATGGACACGTGCAGGCCAGCCTGTTTTA
CGACCACCGTCAGCGCCTGTTGAGCGCCACCGATGCGGAAGCCCGCACTCAGCAACTGCGCTACGACCAG
CAGGACAGACTGACCACCTGGACACGCCCGGATGGTGCCACCTATCGGCTGGGTTATCGCCGGGCAAGCT
GGCGACTGCCGGAGCAACTGATACGCCCGGACGAGAAAGAGGAAAAACGCCAGTACGACAAGCATAACAA
CCTGCTGAACTACACCGACGGCAACGGTGCGGTCTGGCAGCAAACCTACGGCCCGTTCGACCTGCTGACT
TCACGCACCGACGCTGAAGGCCGCACCTGGCAGTACGACTATGATAAAGACAGTCAGCAACTGATTGGTG
TCACCGCCCCGGATGGCAACCGCTGGCAGTGGTGGCTGGATGCGGACGGACGGGTTATCCGTGAGCGGGA
CATGGCCGGTACGGAAACCCACTACGGCTATGACGAAGACGGGCACTGCATCAGCGTGCGCAATGGCGAA
GGGGAAATCCGCCACTTTCTGTACGACGGGCGCGGCCTGCTTATCAAAGAAACCGCGCCGGACGATACGC
TGTATTACCGCTATGATGCGGCCGGTCGACTGACCGACGTGACATCGACCACCAGTCATGTCCAGCTTGA
ATATGACGAGCGTGACCGGGTGGTACAGGAGCATAACAGCGGCACGGCAATCCGACGCCACTATCAGGAC
GCATCGCACACCGTTACCCGCAGCCTGCACTGGGAAGGCGAAGAGGACAGCGCGGCACTGACCAGCACCT
TCTGCTACCGCGCCACGGGCGAACTGCATCAGGTGCAGTTGCCGGATGGCGCCGAGCTGACACTGACTCA
CGATGCGGCTGGGCGGGAAGCCATCCGCCACAGCCCGGGCGGTTTTATACAGCGGCGTGAATACGACACG
ATGGGCTGGCTGACGCGGGAGATGAGCGGGCAGACGGTTGACGGTCGCCTGCAGCCGGTACAGACGCGGG
AATACCTCTACGACAGCGCGGGTAACCTGACGGGCACCCGGCGCAACCGTGAGGCTGCAGGTTACCGACT
GGATGCCAGCGGACGGGTGCTGTCGGTACTGAGCGGTGGTGCGGGGCGCACCGTCAACACCGAAGAGGAA
TACCGCTACACCCGCAGCGGGCTGCCGCAGGATGCGACAAGGCTGACCGACTGGCAGGCCGGACGCCTGA
CCCAGCAGGACAACACTCACTATCAGTACGACAAGGCCGGGCGACTCATTCGCCGGCAGGTGGTGCAACC
GGGCTATCGGCCACAGGTGTGGCACTACCGCTGGGACAGCCGCAATCAGCTCAGAGTAGTGGACACCCCA
AACGGTGAACGCTGGCTCTACCGCTACGACCCGTTCGGACGGCGCATCGGCAAACGCTGCGACCAGACAG
CCGAAGCTATCCGTTATCTGTGGGACGGTGACCAGATAGCGGAGGTGCGGCACTATCGCGACAATCAACT
TGTCTCACGGCGCCACTGGGTGCACAACGGCTGGGAACTGCTGGTGCAGCAGCGTCAGAACGCCGACGAA
AGCTGGGAAACGGACTTTGTCACCAGCGGCCATAACGGTGAACCGCAGGCTATTTTCAACCAGACCGGTG
AACTGCGCTGGCAGGCCCCCCGCGCTAACTTATGGGGCCAGCGCTATACGGAAAACGCTGAAAAATATGA
TCCGGGGCTGGCGTTTGCCGGACAATACCGTGACGACGAAAGTGGCTTATGCTATAACCGTTTCAGGTAT
TATGACCCGAACGGCGGTTGTTATATCTCGCCTGACCCTATAGGGGTGTTGGGTGGGGAAAGTAATTACG
GGTATGTTCATAATCCTGTAAGTTGGATCGATCCGAAAGGGTTAGCTGGATGTAATATAGTCCATAGGGC
GGTGACTCCTGAACAAGCAGCAAGTATCCGGGCAGGCAATGGAATATCAAGGCCGACTCCATATCATAGA
ACGACACCGACTCAGCATGTAGCAGGAGCACCGCACTCGCGTGATCCGTGGATATCAACAACTAGAAGTC
AATCAACGGCAGAATACTTCGCCACTCATGGTGGAACCCAAGCAGCAAATCCAATTGTTAAGATAGATCT
GTCTAAAATTCCGAGCGATAAGATTTTAGATGTATCAAACGCTCAAAAGGCTGCGGAACATTTGCAGACT
CCATTCACCCGAAATGTAGCAGCAGCCCACCAAGAGGTATTAATCTTTGGAGAAATACCATCGGAAGCGA
TAATTGGATTTTTATAG