SecReT6
Effector Protein ID: 470152855
-
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_0358
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]395453..395971 [+]
ProductHcp protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDK4FPT5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|470152855|ref|YP_006281357.1| Hcp protein [Pectobacterium sp. SCC3193]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDATIVDVNCQMPHCQDPAKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|470152509|ref|NC_017845.1|:395453-395971 Pectobacterium sp. SCC3193, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACACAGGGCAACATCACCGCAGGGGCTTTCACCT
CTGATTCTGTCGGCAACATCTACGTGGAAGGCCACGAAGACGAAATGCTGGTGCAGGAATTCAAGCACAT
CGTCACCGTACCAACCGACCCGCAGTCCGGTCAGCCATCCGGTCAGCGTGTCCACAAACCGTTCAAGTTC
ACCGTCGCGCTGAACAAAGCGGTACCGCTGATGTACAACGCCCTCGCCTCCGGCGAAATGCTGCCAACCG
TCACCCTGAAGTGGTATCGCACCTCAGTGGAAGGCAAACAGGAGCACTTCTTCTCTACCGTGCTGACCGA
TGCCACCATCGTTGACGTTAACTGCCAGATGCCACACTGCCAGGACCCGGCCAAGCTGGACTACACCCAA
CTGATTGAAGTCTCGCTGGCCTACCGCAAAATCGACTGGGAGCACACCGTCGCCGGCACCTCTGGCTCCG
ACGACTGGCGCGCGCCGGTCGAAGCCTAA