SecReT6
Effector Protein ID: 470153049
-
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_0553
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]601540..601914 [-]
ProductHcp protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDK4FET9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.40E-23, Aligned region: 15..108
Protein Sequence: 124 a.a.     [Download]
>gi|470153049|ref|YP_006281551.1| Hcp protein [Pectobacterium sp. SCC3193]
MRQCPQSNSETFWAMNYKPFKFTVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDA
TIVDVNCQMPHCQDPAKLDYTQLIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
-
Nucleotide Sequence: 375 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c601914-601540 Pectobacterium sp. SCC3193, complete genome
ATGCGGCAATGCCCCCAGAGCAACAGCGAAACGTTCTGGGCGATGAACTACAAACCGTTCAAGTTCACCG
TCGCGCTGAACAAAGCGGTGCCGCTGATGTACAACGCCCTCGCCTCCGGCGAAATGCTGCCAACCGTCAC
CCTGAAGTGGTATCGCACCTCGGTAGAAGGAAAACAGGAGCACTTCTTCTCTACCGTGCTGACCGATGCC
ACCATCGTTGACGTTAACTGCCAGATGCCACACTGCCAGGACCCGGCCAAGCTGGACTACACCCAACTGA
TTGAAGTCTCGCTGGCCTACCGCAAAATCGACTGGGAGCACACCGTCGCCGGCACCTCCGGCTCTGACGA
CTGGCGCGCGCCGGTCGAAGCCTAA