SecReT6
Effector Protein ID: 470153932
-
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_1468
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1611045..1612895 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDK4FGB5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-66, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.90E-22, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 0.0025, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 0.0025, Aligned region: 509..530
Gp5_C [PF06715], Evalue: 0.0025, Aligned region: 516..538
Gp5_C [PF06715], Evalue: 0.0025, Aligned region: 543..554
Gp5_C [PF06715], Evalue: 0.0025, Aligned region: 566..572
Gp5_C [PF06715], Evalue: 0.0025, Aligned region: 605..611
Protein Sequence: 616 a.a.     [Download]
>gi|470153932|ref|YP_006282434.1| VgrG protein [Pectobacterium sp. SCC3193]
MANSTGLQFTVKVGALPESTFAVVDFQLSEALNQPFSLSLNLASPVPGIDFGAVLDQPCELLVWYEGELK
RRVSGIVSAFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEESGITDYAFALRHD
HAPREYCVQYRESDLAFVARLAAEEGLYFFHEFEAGKHRVVFADDAGALGKGPELFFNLATQGLSEGEYV
RRFRYAEAVSTAEVALKDYSFKTPAYGLLHSKMSGELANQRESYQHYDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGSGESNAAMLMPGSSFTLTEHPNPTLNSGWQLVVITHSGQQPQALEEESGGEPTTYSNSFEVIS
AKSTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTSTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRSTTVTADHTENVGGNQAVSVIKDQSTEIQGQQTIAISGSRSTVVGDATAT
EDVHDSLQVKNNILIQSKQGGILIANGIGFFSISDKGDITIKGNTVTINGNRIDLN
-
Nucleotide Sequence: 1851 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1611045-1612895 Pectobacterium sp. SCC3193, complete genome
GTGGCAAACAGTACAGGATTACAGTTCACGGTAAAGGTCGGTGCATTGCCCGAGAGCACCTTTGCGGTGG
TGGATTTTCAGCTCAGCGAGGCACTGAACCAGCCGTTTTCCCTGTCGCTGAATCTGGCCAGCCCGGTGCC
GGGTATCGACTTTGGTGCCGTGCTGGATCAGCCGTGTGAACTGCTGGTGTGGTACGAAGGTGAACTCAAG
CGCCGTGTCAGCGGCATTGTCAGCGCCTTTGCGCAGGGCGACACCGGTTTTCGCCGTACCCGCTATCAGG
CAGAAGTGCGACCGGCGCTGTGGCGGCTGGGGCTGCGCACCAATGCACGGATCTTTCAGGCACAGAAGCC
AGAAGCGATTATTGGTACGTTGCTGGAAGAGTCCGGCATCACCGACTACGCCTTTGCGCTGCGGCACGAC
CACGCGCCCCGCGAATACTGTGTGCAGTACCGGGAAAGTGATTTGGCCTTTGTCGCCCGTTTGGCGGCTG
AGGAAGGCCTGTACTTTTTCCATGAGTTTGAAGCCGGTAAGCACCGGGTCGTCTTTGCCGATGACGCCGG
GGCGCTTGGCAAAGGCCCGGAACTGTTCTTCAACCTCGCCACGCAGGGGCTGAGTGAAGGCGAATATGTC
CGCCGTTTCCGCTACGCCGAAGCGGTCAGTACCGCCGAAGTCGCGCTCAAGGATTACAGCTTCAAAACCC
CTGCCTACGGCCTGCTGCACAGCAAGATGAGCGGCGAATTGGCGAACCAACGCGAAAGCTACCAGCACTA
TGACTACCCCGGACGCTTTAAACAAGACCCGAGCGGTAAGGCCTTTACCGGCTACCGGCTGGATGCGCTA
AGAGCGGGGGCGATGACCGGCTCCGGTGAATCCAATGCCGCGATGTTGATGCCGGGCAGCAGTTTTACCT
TAACCGAACATCCCAACCCGACGCTGAATAGTGGCTGGCAACTGGTGGTGATCACCCACAGTGGGCAGCA
ACCGCAGGCGCTGGAAGAAGAAAGCGGCGGCGAGCCGACGACCTACAGCAACAGCTTTGAGGTGATTAGT
GCCAAAAGCACCTGGCGTGCCGATCTGCCCTACAAACCGATGGTGGATGGCCCGCAGATTGCCACCGTGG
TCGGCCCGGCAGGTGAGGAAATCTACTGCGACGAATACGGGCGCATCAAACTGCAATTCCCGTGGGATCG
CTACGGAGCCAGCGATGACCAGAGTTCCTGCTGGGTGCGCGTCAGTCAGGGCTGGGCAGGCGGTCAGTAC
GGCCTGATAGCCATCCCACGCATCGGCCATGAGGTGATTGTCAGTTTTCTGGAAGGCGACCCCGACCAGC
CGATTGTGACGGGTCGTACCTTCCACGCCACTAATCCGTCACCGTATCCACTGCCAGCGAACAAGACACG
CACCTCGCTGCGTACGTCAACGCATAAGGGCGCGGGATTCAATGAACTGCGCTTTGAAGACCAGGCCGGG
CAGGAAGAGGTGTTTATCCATGCTCAGAAAGACATGAACACCGTGGTGCTGAATAACCGCAGTACTACCG
TGACGGCTGACCATACCGAAAACGTCGGTGGCAATCAGGCAGTGTCCGTCATCAAAGACCAGTCCACTGA
AATCCAGGGGCAGCAAACCATTGCCATCTCCGGTAGCCGCAGCACCGTTGTGGGCGACGCCACGGCAACG
GAAGACGTTCATGACAGCCTGCAGGTGAAAAACAACATCCTTATCCAGTCGAAACAGGGCGGCATCCTGA
TTGCCAACGGCATCGGTTTTTTCAGTATCAGCGATAAAGGTGACATCACCATCAAGGGTAACACCGTCAC
CATCAACGGCAATCGTATCGATCTGAACTAA