SecReT6
Effector Protein ID: 470155953
-
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_3513
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]3779123..3783394 [-]
ProductYD repeat protein
Effector typeProtein
Homologous effectorDda3937_02773
DescriptionRhsB
UniProt IDK4FM60
KEGG IDpec:W5S_3513
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 466..494
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 486..513
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 553..585
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 594..627
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 612..646
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 654..671
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 676..713
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 741..778
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 766..799
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 810..842
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 847..880
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 867..899
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 887..908
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 935..961
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 975..995
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 977..1015
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 1006..1042
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 1068..1089
RHS_repeat [PF05593], Evalue: 5.30E-54, Aligned region: 1107..1136
PAAR_motif [PF05488], Evalue: 3.80E-18, Aligned region: 113..179
DUF4595 [PF15283], Evalue: 4.50E-07, Aligned region: 505..550
DUF4595 [PF15283], Evalue: 4.50E-07, Aligned region: 588..634
DUF4595 [PF15283], Evalue: 4.50E-07, Aligned region: 648..677
DUF4595 [PF15283], Evalue: 4.50E-07, Aligned region: 774..866
DUF4595 [PF15283], Evalue: 4.50E-07, Aligned region: 865..957
DUF4595 [PF15283], Evalue: 4.50E-07, Aligned region: 977..1084
DUF4595 [PF15283], Evalue: 4.50E-07, Aligned region: 1067..1165
DUF4150 [PF13665], Evalue: 0.00038, Aligned region: 114..134
DUF4150 [PF13665], Evalue: 0.00038, Aligned region: 139..172
RHS [PF03527], Evalue: 0.00067, Aligned region: 568..581
RHS [PF03527], Evalue: 0.00067, Aligned region: 632..646
RHS [PF03527], Evalue: 0.00067, Aligned region: 1051..1062
RHS [PF03527], Evalue: 0.00067, Aligned region: 1200..1218
Protein Sequence: 1423 a.a.     [Download]
>gi|470155953|ref|YP_006284455.1| YD repeat protein [Pectobacterium sp. SCC3193]
MRDEILARIARVGAMHAGNRPTLPPDLPAPGSGSPPTSPGKPIKHSSFLGALLGAVAGALVAAAVAAVAV
ALVGVTGGLAIAVVGGLAVLGAGSLISAVSGRVSAMVDSASPPAGKVDSGSPNVSVEGNPVSRAEVDVVL
CTKHNGPQLIAQGSETVFVNGHPAARIGDKTVCGATIKDGASTVFFGSGQATVLEIQDEFSGWQKALLIA
VEFLVPPTRGLFKGLGKLFYRGPKAVMKGMGAGALWAGKRFTQKTRCATRAFKANKGRARYKEAAKAFKK
DPVYIASGEVIENRIDLALGQTIPLVFERTYRTASSHVGLLGRGWQDSWSEVATVSQDDGGIHVTLTLAQ
GYDIDFTFGLGATVVYCAEYPEFKLLRRHNSFHLWHRDSQTWRAFTVKQGDQLLLSAITDNHQNRIDFLR
DPKGYLRKIQHSDGIELLLVWQGEFLRQVQRIDGGQKTVLAEYRQDEQGRLVEADAAHAYHLFYEYDNHH
RLTRWHDNDKTWARYEYDQQGRCIYTTCADGYLTATFEYLADRVVMTDGLGQRSEYGFNDLHLMAWEKSP
LGHITRYEYDDVGNLLREISPAGRVVEFAYLEDTGLVSTFTDGSDHQWQYAYDDHERLIGITDPLGRNWA
WQYDSKGNPQSLTGPDNSEVRFAWNRYGLLTEVSDHNGQVQASLFYDHRQRLLSATDAESRTQQLRYDQQ
DRLTTWTRPDGSTYRLGYRRASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGNGAVWRQTYGAFDLLTS
RTDAAGRTWQYEYDKESQQLVCVTAPDGNQWQWWLDADARVIRERDMAGTETHYGYDEDGHCITVRNGEG
ETRHFLYDGRGLLIKETAPDDMLHYRYDAAGRLTEVTSATSHIQLSYDERDRVVEEHNSGSVVMRHYQEA
SHTVTRSLFWEGEEDSAALTSSFCYSATGELRQIQLPDGAELTLAYDAAGRESIRQSKGGFTQKREYDVM
GWLTREMSGQTADGRLQPTQTREYLYDGAGNLTGTRRNREAAGYRLDATGRVLEVLSGGAGRTVNTEEQY
RYTRNGLPQETTRLTEWQAGRLTQYDDTHYQYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPT
GERWFYRYDPFGRRTGKRCDQTQDELRYLWDGDQIAEVRHYRDNQLISRRHWVHNGWELLVQQRQNTDGS
WQTDFVSSGHNGEPQAIFNPQGELRWQAPRTNLWGQRYTENTESLDPGLAFAGQYRDAESSLCYNRFRYY
DPSGGCYISPDPISILGGDNNYGYVHNPVNWIDPFGLAGCANVDKDGTLSIKNKFSPGSAEDLALQKHVA
DWNAQIKANGGSMTRQAVSPEMRASANNAANAAKRATPELYPKGTAPGHTPDVGWGGATEGPIIPLMSRV
NSYIGGATQAVPVGTTYFKVILI
-
Nucleotide Sequence: 4272 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c3783394-3779123 Pectobacterium sp. SCC3193, complete genome
ATGCGTGATGAAATTCTGGCCCGTATTGCGCGTGTCGGCGCTATGCATGCGGGCAATCGGCCCACGCTGC
CACCCGATTTACCGGCACCCGGTAGCGGCTCGCCGCCGACCTCGCCGGGCAAGCCTATCAAGCACAGCAG
CTTTCTGGGGGCGCTGCTCGGTGCCGTTGCCGGGGCGCTGGTTGCTGCTGCGGTTGCGGCGGTGGCCGTT
GCTCTGGTGGGCGTCACCGGTGGACTGGCGATTGCCGTGGTCGGTGGGCTGGCGGTGCTGGGGGCAGGAA
GCCTGATATCGGCGGTCAGTGGTCGGGTATCCGCCATGGTGGACAGTGCCTCACCGCCTGCGGGGAAAGT
GGACAGTGGTTCACCGAATGTGTCGGTGGAAGGGAATCCGGTTTCCCGAGCTGAAGTCGATGTCGTTCTC
TGCACCAAACACAACGGTCCGCAACTGATTGCGCAGGGCAGCGAAACCGTCTTTGTGAACGGTCATCCGG
CTGCACGGATTGGTGATAAAACCGTGTGTGGTGCCACCATCAAGGACGGTGCATCGACGGTGTTCTTTGG
CTCCGGTCAGGCTACCGTACTGGAGATACAGGACGAGTTCAGCGGCTGGCAGAAAGCGCTGCTGATTGCG
GTGGAATTTCTGGTGCCGCCGACCCGTGGCCTGTTTAAGGGGCTGGGGAAACTCTTTTATCGCGGCCCGA
AAGCGGTGATGAAAGGGATGGGCGCTGGCGCGCTCTGGGCCGGGAAACGTTTCACGCAAAAGACACGTTG
TGCCACCCGGGCATTTAAGGCGAACAAGGGTCGGGCACGATATAAAGAAGCAGCCAAAGCCTTTAAGAAA
GACCCGGTGTATATCGCCAGCGGTGAAGTGATTGAAAACCGTATCGACTTGGCACTGGGGCAGACCATCC
CGCTGGTATTCGAACGCACCTATCGTACTGCTTCTTCACATGTTGGGTTGTTAGGCCGTGGCTGGCAGGA
TAGCTGGAGCGAGGTCGCTACCGTCAGTCAGGATGATGGCGGCATCCATGTCACACTCACGCTGGCACAG
GGCTATGATATTGATTTCACCTTCGGGCTCGGTGCCACCGTGGTGTACTGCGCCGAATACCCCGAATTCA
AGCTGCTGCGACGGCATAACAGTTTTCACCTGTGGCACCGCGACAGCCAGACCTGGCGTGCCTTTACCGT
CAAACAGGGTGACCAGTTGCTGTTGTCGGCCATTACCGACAACCACCAGAACCGAATCGACTTTCTCCGC
GACCCCAAAGGCTACCTGCGCAAGATACAGCACAGCGACGGCATCGAACTGCTGCTGGTGTGGCAGGGGG
AATTTCTGCGCCAGGTGCAGCGCATTGACGGTGGTCAGAAAACCGTGCTGGCCGAATACCGTCAGGATGA
GCAAGGCCGACTGGTCGAGGCAGATGCCGCTCATGCCTATCACCTGTTCTACGAGTATGACAACCATCAT
CGTCTGACTCGTTGGCACGACAACGACAAAACCTGGGCGCGTTATGAGTATGACCAGCAAGGCAGGTGCA
TCTACACCACCTGTGCTGACGGCTACCTGACGGCGACGTTTGAGTACCTGGCCGACCGGGTGGTGATGAC
GGATGGGTTAGGCCAACGCAGTGAATATGGCTTCAATGACCTGCACCTGATGGCGTGGGAAAAATCCCCG
CTCGGCCATATCACCCGCTATGAGTATGACGACGTGGGCAACCTGCTGCGGGAAATTTCCCCGGCGGGCC
GGGTGGTGGAATTTGCCTATCTGGAGGATACCGGACTGGTCAGCACCTTCACCGACGGCAGCGACCACCA
ATGGCAGTACGCCTACGACGACCATGAGCGGCTTATCGGTATTACTGACCCACTCGGGCGCAACTGGGCA
TGGCAGTACGACAGCAAGGGCAACCCGCAGAGCCTGACCGGGCCGGACAACAGCGAAGTGCGTTTTGCCT
GGAATCGCTACGGCCTGCTGACTGAAGTCAGCGACCATAACGGTCAGGTACAGGCCAGCCTGTTTTACGA
CCACCGTCAGCGCCTGCTGAGTGCCACGGATGCGGAGTCCCGCACTCAGCAACTGCGCTACGACCAGCAG
GACAGGCTGACCACTTGGACACGCCCGGATGGCTCAACCTATCGGCTGGGTTATCGCCGTGCAAGCTGGA
AGCTGCCGGAGCAACTACTGCGTCCGGACGACAAGCAAGAGCAGCGCCAGTATGACAAGCACAACAACCT
GCTGAACTATACCGACGGCAACGGCGCGGTATGGCGACAAACCTATGGCGCGTTTGATTTGCTGACGTCA
CGTACCGATGCGGCAGGTCGCACCTGGCAGTACGAGTATGACAAGGAAAGTCAGCAACTGGTGTGTGTCA
CGGCACCGGACGGTAATCAGTGGCAGTGGTGGCTGGATGCCGATGCGCGGGTTATCCGCGAACGGGACAT
GGCGGGTACGGAGACCCACTACGGCTATGACGAAGACGGCCACTGCATCACCGTTCGCAATGGCGAAGGA
GAAACCCGCCACTTCCTGTACGACGGGCGCGGATTACTGATAAAAGAAACGGCACCAGACGATATGCTGC
ACTACCGCTACGATGCGGCAGGCAGGCTTACTGAAGTCACGTCCGCGACCAGTCATATCCAGTTGTCGTA
TGACGAGCGCGACCGTGTGGTAGAGGAGCACAACAGCGGTTCGGTAGTGATGCGCCACTATCAGGAGGCA
TCGCACACCGTTACCCGCAGCTTGTTCTGGGAAGGTGAAGAAGACAGCGCGGCACTTACCAGTTCCTTCT
GCTATAGCGCGACGGGTGAACTGCGTCAGATACAGTTACCGGACGGTGCAGAGCTGACGCTGGCTTATGA
TGCTGCTGGACGTGAATCTATCCGCCAGAGCAAGGGCGGTTTTACGCAGAAACGTGAATACGATGTCATG
GGCTGGCTGACGCGGGAAATGAGCGGCCAGACGGCTGACGGTCGGTTGCAACCGACCCAGACGCGGGAAT
ACCTGTACGACGGTGCGGGCAACCTGACCGGCACCCGGCGCAACCGCGAAGCGGCAGGCTACAGGCTCGA
TGCCACCGGACGGGTGTTGGAGGTACTGAGTGGGGGCGCGGGTCGCACTGTTAACACCGAAGAACAATAC
CGCTACACCCGCAACGGTCTGCCGCAGGAGACCACCCGACTCACCGAGTGGCAGGCGGGTCGGCTGACTC
AGTACGACGATACTCACTATCAGTACGACAAAGCCGGGCGGCTTATCCGTAAACAGGTGGTACAACCGGG
CTATCGCCCACAGGTCTGGCACTACCGCTGGGACAGCCGTAACCAGCTTCGGGTTGTCGATACCCCGACG
GGCGAACGCTGGTTCTACCGCTACGACCCGTTCGGCCGACGTACCGGCAAACGCTGTGACCAGACGCAGG
ACGAACTCCGCTACCTGTGGGACGGCGACCAGATTGCTGAGGTGCGGCACTACCGCGACAACCAACTTAT
CAGCCGCCGTCACTGGGTGCATAACGGCTGGGAGCTGCTGGTGCAGCAGCGCCAGAATACAGACGGTAGC
TGGCAAACGGATTTTGTCAGCAGCGGCCATAACGGTGAACCGCAGGCCATCTTTAATCCGCAAGGTGAGC
TGCGCTGGCAGGCTCCGCGGACCAACTTATGGGGCCAAAGATATACAGAGAATACTGAAAGTCTTGATCC
GGGACTGGCCTTTGCCGGGCAATACCGTGACGCGGAAAGTAGCTTATGCTATAACAGGTTCCGTTATTAT
GATCCAAGCGGTGGTTGTTATATCTCGCCAGACCCGATCAGCATTTTGGGGGGGGATAATAACTATGGAT
ATGTTCATAACCCAGTTAATTGGATTGATCCGTTTGGTTTAGCTGGTTGTGCGAATGTCGATAAGGATGG
AACCCTAAGCATTAAAAATAAATTCTCTCCAGGATCAGCAGAAGATTTGGCATTACAGAAGCATGTTGCA
GATTGGAACGCTCAAATAAAGGCGAATGGTGGTTCAATGACAAGGCAAGCTGTAAGTCCAGAAATGCGTG
CATCTGCTAATAATGCGGCTAACGCAGCCAAGAGAGCAACACCTGAGTTATATCCAAAAGGAACAGCCCC
TGGTCATACCCCCGATGTTGGGTGGGGGGGAGCAACGGAAGGACCAATAATTCCTCTTATGTCTAGAGTA
AATAGCTACATCGGCGGGGCAACACAAGCAGTTCCTGTTGGAACTACATATTTTAAAGTAATTCTTATTT
AA