SecReT6
Effector Protein ID: 470155955
-
SecReT6 ID650
T6SS typeA3
Gene symbol-
Locus tagW5S_3515
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]3783859..3785688 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDK4FXB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-66, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.30E-22, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 0.00039, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 0.00039, Aligned region: 516..538
Gp5_C [PF06715], Evalue: 0.00039, Aligned region: 549..565
Protein Sequence: 609 a.a.     [Download]
>gi|470155955|ref|YP_006284457.1| VgrG protein [Pectobacterium sp. SCC3193]
MANSTGLQFTVKVGALPESTFAVVDFQLSEALNQPFALSLNLASALPGIDFGTVLDQPCELLVWYEGILQ
RRVSGIISAFAQGDTGFRRTRYQAEVRPALWRLGLRTNARLFQAQKPEAIIGTLLEESGITDYAFALRHD
HAQREYCVQYRESDLAFITRLAAEEGLYFFHEFEEGKHRVVFADDAGALVKGPELFFNLATQGLSEGEYV
RRFRYAEAVSTAEVALKDYSFKTPAYGLLHSKISGELAHQRESYQHYDYPGRFKQDPSGKAFTSYRLDAL
RANAMTGSGESNAAMLMPGSSFTLTEHPNPTLNSGWQLVAITHSGQQPQALEEESGGEPTTYSNSFEVIS
AKSTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGSSDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTSTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRTTSVTADHTESVGGNQAVSVVKDQSTEIQGQQSIAVTKNRNTVVDDNDSL
QVKNNIAIQSQKGDILIATDKGFIGIGADGVINIKGTHIVINGQQIDLN
-
Nucleotide Sequence: 1830 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c3785688-3783859 Pectobacterium sp. SCC3193, complete genome
GTGGCAAACAGTACAGGACTACAGTTCACGGTAAAAGTCGGCGCACTGCCGGAAAGCACCTTTGCCGTGG
TGGATTTTCAGCTCAGCGAGGCGCTTAACCAGCCGTTTGCCCTGTCGCTGAATCTGGCGAGTGCCTTACC
GGGTATCGACTTTGGCACCGTGCTCGACCAGCCGTGTGAGCTGCTGGTGTGGTACGAAGGTATACTCCAA
AGACGAGTGAGCGGGATTATCAGCGCCTTTGCACAGGGCGACACCGGTTTTCGCCGTACCCGCTATCAGG
CGGAAGTCCGTCCGGCCTTGTGGCGGCTGGGGCTGCGCACCAACGCCCGCCTCTTTCAGGCACAAAAGCC
AGAGGCGATTATCGGTACGTTGCTGGAAGAGTCTGGCATTACCGATTATGCCTTTGCCCTGCGTCACGAC
CACGCTCAACGTGAATACTGCGTACAGTATCGTGAAAGTGATTTAGCCTTTATTACTCGTCTGGCAGCGG
AAGAAGGGCTGTACTTCTTCCATGAGTTTGAAGAAGGCAAGCACCGCGTCGTCTTTGCGGATGATGCAGG
CGCATTGGTAAAAGGTCCTGAGCTATTTTTCAACCTGGCGACACAGGGGCTGAGCGAAGGCGAATATGTC
CGCCGTTTCCGCTACGCCGAAGCGGTCAGCACCGCCGAAGTCGCCCTCAAGGACTACAGCTTTAAAACCC
CGGCCTACGGCCTGCTGCACAGCAAGATAAGCGGTGAACTGGCACATCAGCGCGAAAGCTATCAGCACTA
TGATTACCCTGGACGATTCAAACAAGACCCGAGCGGCAAGGCCTTTACCAGCTACCGGCTGGATGCGTTA
CGCGCCAATGCGATGACCGGTTCGGGTGAATCCAATGCCGCCATGCTGATGCCCGGCAGCAGTTTTACCT
TAACCGAACATCCTAATCCGACGCTGAATAGTGGCTGGCAACTGGTTGCCATCACGCACAGCGGGCAGCA
GCCGCAGGCGCTGGAAGAGGAAAGCGGCGGTGAACCGACCACCTACAGCAACAGCTTTGAGGTTATCAGC
GCCAAGTCTACCTGGCGTGCCGATTTACCGTACAAACCGATGGTCGATGGTCCGCAAATTGCCACCGTTG
TCGGCCCGGCGGGTGAGGAAATCTACTGTGACGAATATGGCCGCATCAAACTGCAATTCCCGTGGGACCG
CTACGGCTCCAGCGACGACCAGAGCTCCTGCTGGGTACGCGTCAGTCAGGGCTGGGCGGGCGGCCAATAT
GGCCTGATAGCCATCCCACGCATCGGCCATGAAGTGATTGTCAGCTTCCTCGAAGGCGACCCGGACCAGC
CGATTGTGACAGGCAGAACTTTCCACGCCACCAATCCGTCGCCGTATCCACTGCCAGCGAACAAGACACG
CACCTCGCTGCGTACGTCAACGCACAAGGGGGCGGGTTTCAATGAGCTGCGTTTTGAAGACCAGGCTGGG
CAGGAAGAGGTGTTTATCCATGCCCAGAAAGACATGAACACCGTGGTGTTGAATAACCGCACGACCAGCG
TGACCGCTGACCACACCGAAAGCGTCGGTGGCAATCAGGCGGTATCGGTCGTGAAAGACCAGTCCACTGA
AATCCAGGGGCAGCAGAGCATCGCCGTGACCAAAAACCGCAACACGGTCGTGGATGACAACGACAGCCTT
CAGGTGAAAAACAACATCGCTATCCAGTCGCAGAAGGGGGACATCCTGATAGCCACGGACAAGGGGTTTA
TTGGTATCGGTGCGGACGGGGTCATCAATATCAAGGGTACCCACATTGTCATCAACGGCCAGCAAATCGA
CCTGAACTGA