SecReT6
Effector Protein ID: 470156029
SecReT6 ID650
T6SS typeA3
Gene symbol-
Locus tagW5S_3590
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]3853714..3855396 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDK4FLU1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-55, Aligned region: 1..233
Phage_base_V [PF04717], Evalue: 3.00E-22, Aligned region: 272..364
Phage_base_V [PF04717], Evalue: 3.00E-22, Aligned region: 492..515
Gp5_C [PF06715], Evalue: 1.30E-06, Aligned region: 411..428
Gp5_C [PF06715], Evalue: 1.30E-06, Aligned region: 429..451
Gp5_C [PF06715], Evalue: 1.30E-06, Aligned region: 460..476
Protein Sequence: 560 a.a.     [Download]
>gi|470156029|ref|YP_006284531.1| VgrG protein [Pectobacterium sp. SCC3193]
MRPALWRLGLRTNARIFQAQKPDAIIGTLLEEAGITDYAFSLRHDHAPREYCVQYRESDLAFVTRLAAEE
GLYFFHEFEEGKHRVVFADDAGALAKGPELFFNLAAQGLSEGEYIRRFHYAERVSTAEVELKDYSFKTPA
YGLSHKKMSSELDHQRESYQHYDYPGRYKQDPSGKAFSNYRLDALRSGAVTSEGESNCAGLMPGNTFTLT
EHPNATLNTVWQTVSVMHIGQQSQALEEESGGEPTTMSNSFAVISAKKNWRAVMPYKPMVDGPQIARVVG
PAGEEIYCDKYGRIKLQFPWDRYGANNDQSSCWVRVSQGWAGGQYGLIAIPRIGHEVIVSFLEGDPDQPI
VTGRTFHATNPAPYPLPANKTRTTLRSKTHKGKGFNELSFEDATDNEEIFLHAQKNMAVRVLNSKDERVD
YNRTTSIGHDEALVVANDRKITVEGNQDHKITGNNLSLTEGDRGIQVKGDLAQKISGVFSVDSNGDLTLQ
SGSKLTLRVGGSFVVIHAGGVDIKGPAINLNSGGSPGDLALPADPAILKAAAAQGTMFVAHCPAKEKKGE
-
Nucleotide Sequence: 1683 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c3855396-3853714 Pectobacterium sp. SCC3193, complete genome
GTGCGTCCGGCGCTGTGGCGGCTGGGCTTACGCACCAACGCCCGCATTTTTCAGGCGCAGAAACCAGACG
CGATTATCGGTACTCTGCTGGAAGAAGCCGGCATTACCGACTACGCCTTTTCGTTACGTCATGACCATGC
CCCGCGCGAGTACTGCGTTCAGTACCGGGAAAGCGATTTGGCGTTTGTCACCCGACTGGCGGCAGAGGAA
GGCTTGTACTTCTTCCACGAGTTTGAGGAAGGCAAACACCGTGTCGTCTTTGCCGACGATGCGGGAGCGC
TGGCTAAGGGCCCTGAGCTGTTCTTCAATTTGGCGGCGCAGGGGCTGAGCGAGGGGGAATACATCCGGCG
TTTCCACTATGCGGAGCGGGTGAGCACGGCAGAAGTGGAGTTGAAGGATTACAGCTTCAAGACACCGGCC
TACGGGCTGTCACATAAGAAGATGAGTAGCGAATTGGATCACCAACGTGAAAGTTATCAGCATTACGACT
ATCCAGGACGTTATAAACAAGATCCGAGCGGCAAAGCGTTCAGCAACTACCGGCTGGATGCGCTGCGCTC
TGGAGCGGTGACGAGCGAAGGGGAATCGAACTGCGCAGGGCTGATGCCGGGCAACACGTTTACTCTGACG
GAACACCCGAATGCGACGCTGAATACGGTGTGGCAAACGGTGAGCGTGATGCATATCGGGCAGCAGTCGC
AGGCGCTGGAGGAGGAAAGCGGCGGTGAGCCGACGACCATGAGCAACAGCTTTGCGGTTATCAGTGCGAA
AAAAAACTGGCGGGCCGTCATGCCGTACAAACCGATGGTGGACGGCCCGCAGATTGCGAGGGTAGTGGGG
CCGGCTGGCGAAGAAATCTACTGCGACAAGTACGGGAGAATCAAACTGCAATTCCCGTGGGACCGTTATG
GGGCGAATAATGACCAGAGTTCCTGCTGGGTGCGTGTTAGCCAGGGCTGGGCGGGCGGCCAATACGGACT
GATCGCTATCCCGCGTATCGGTCATGAAGTGATTGTTAGCTTCCTCGAAGGTGACCCGGATCAGCCGATT
GTCACTGGACGTACCTTCCACGCGACAAATCCAGCGCCGTATCCGCTGCCAGCCAATAAAACACGTACCA
CGCTACGTTCAAAAACACACAAAGGAAAAGGCTTTAACGAACTCAGTTTTGAGGACGCGACCGATAACGA
AGAGATCTTCCTTCATGCCCAGAAGAACATGGCAGTACGGGTACTGAATTCTAAAGATGAGCGAGTGGAC
TATAACCGAACAACCAGTATTGGGCATGATGAGGCGCTGGTGGTCGCCAATGACCGTAAGATTACGGTGG
AAGGTAATCAGGATCACAAAATCACAGGCAATAATTTATCGCTGACGGAAGGCGATCGAGGCATACAGGT
TAAGGGCGATTTGGCGCAGAAAATCAGCGGCGTGTTCAGCGTGGACAGCAATGGCGATCTGACGCTGCAA
AGTGGCAGCAAACTGACACTCCGAGTTGGAGGCAGCTTTGTGGTTATCCACGCCGGAGGCGTTGACATCA
AAGGGCCTGCTATCAACCTGAACTCAGGCGGCAGCCCAGGCGATTTGGCACTCCCCGCCGATCCGGCGAT
ATTGAAAGCGGCGGCGGCACAGGGAACGATGTTTGTGGCGCATTGTCCGGCAAAGGAAAAAAAAGGTGAG
TGA