SecReT6
Effector Protein ID: 470156389
SecReT6 ID650
T6SS typeA3
Gene symbol-
Locus tagW5S_3956
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]4273780..4274298 [+]
ProductHcp protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDK4FMP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|470156389|ref|YP_006284891.1| Hcp protein [Pectobacterium sp. SCC3193]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDATIVDVNCQMPHCQDPAKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|470152509|ref|NC_017845.1|:4273780-4274298 Pectobacterium sp. SCC3193, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACACAGGGCAACATCACCGCAGGGGCTTTCACCT
CTGATTCTGTCGGCAACATCTACGTGGAAGGCCACGAAGACGAGATGCTGGTGCAGGAATTCAAGCACGT
CGTCACCGTACCAACCGACCCGCAGTCCGGTCAGCCATCCGGTCAGCGCGTCCACAAACCGTTCAAGTTC
ACCGTCGCGCTGAACAAAGCGGTACCGCTGATGTACAACGCCCTCGCCTCCGGCGAAATGCTGCCAACCG
TCACCCTGAAGTGGTATCGCACCTCGGTAGAAGGCAAACAGGAGCACTTCTTCTCTACCGTGCTGACCGA
TGCCACCATCGTTGATGTTAACTGCCAGATGCCACACTGCCAGGACCCGGCCAAGCTGGACTACACCCAA
CTGATTGAAGTCTCGCTGGCCTACCGCAAAATCGACTGGGAGCACACCGTCGCCGGCACCTCTGGCTCCG
ACGACTGGCGTGCGCCGGTCGAAGCCTAA