SecReT6
Effector Protein ID: 470156390
SecReT6 ID650
T6SS typeA3
Gene symbol-
Locus tagW5S_3957
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]4274487..4276319 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDK4FY53
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-67, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 7.80E-23, Aligned region: 367..460
Protein Sequence: 610 a.a.     [Download]
>gi|470156390|ref|YP_006284892.1| VgrG protein [Pectobacterium sp. SCC3193]
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQSFSLSLNLASALPDVDFGAVLDQPCELLIWFEGELK
RRVSGIISGFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEEAGITDYAFSLRHD
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGEYV
HRFRYAERVSIAEVALKDYSFKTPAYGLLHKKMSSELAHQRESYQHFDYPGRFKKDPSGKAFSRYRLEAL
RANAITGAGDSNAAMLMPGNSFMLTEHPNLPLNTGWQVVAITHSGQQPQALEEESGGEPTTYSNSFEVIS
AKTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNRPPYELPTHKTRTVLRSRTHKGKGFNELRFEDQSG
QEEVFIHAQKDMNTVVLNNRSTKVNIDHSENVGRHQTIMVGENQGTEIRGTQRITVEKGRKTEITTTEEL
TVTGDITVLSASGTIKLSTAGGYISIDNAGDINIVGNHLMLNGVRIDLNQ
-
Nucleotide Sequence: 1833 bp     [Download]
>gi|470152509|ref|NC_017845.1|:4274487-4276319 Pectobacterium sp. SCC3193, complete genome
GTGGCCAACAGTACAGGATTGCAGTTCACCGTGAAGGTCGGCGCGTTGCCGGCCTCGACGTTTGCGGTGG
TCGATTTTCAGCTCAGCGAGGCGCTTAACCAGTCGTTTTCCCTGTCCCTCAATCTGGCCAGTGCCCTGCC
GGATGTGGATTTTGGCGCGGTGCTGGACCAGCCCTGTGAGCTGCTGATTTGGTTCGAAGGCGAGTTGAAG
CGACGGGTGAGCGGGATAATCAGCGGCTTTGCCCAGGGTGACACCGGCTTTCGCCGCACCCGCTATCAGG
CGGAAGTGCGTCCGGCGTTGTGGCGACTCGGCTTACGCACCAACGCCCGCATTTTTCAGGCGCAGAAGCC
AGAGGCGATTATCGGCACCCTGCTGGAAGAAGCCGGGATTACCGACTACGCCTTCTCGTTACGTCATGAC
CATGCCCCGCGTGAATACTGCGTGCAGTACCGGGAAAGTGATTTGGCGTTTGTCACCCGACTGGCCGCCG
AGGAAGGCTTGTACTTCTTCCACGAGTTTGAGGAAGGCAAACACCGGGTGGTCTTTGCCGACGATGCCGG
CGCACTGGCCAAAGGCCCTGAACTGTTCTTCAACCTCGCCACGCAGGGGCTGAGTGAAGGCGAATATGTC
CACCGTTTCCGCTACGCCGAGCGGGTCAGCATCGCCGAGGTGGCGCTCAAGGACTACAGCTTCAAAACCC
CGGCCTATGGCCTGCTGCACAAGAAGATGAGCAGCGAACTGGCACACCAGCGCGAAAGCTATCAGCACTT
TGACTACCCCGGACGCTTTAAAAAAGACCCGAGCGGCAAGGCGTTCAGCCGCTACCGGCTGGAGGCGTTA
CGGGCGAATGCCATCACTGGCGCGGGGGACTCCAACGCGGCGATGCTGATGCCGGGCAACAGTTTCATGC
TCACCGAACACCCCAACCTGCCCCTCAACACTGGCTGGCAAGTGGTTGCCATCACCCACAGCGGACAGCA
ACCGCAGGCGCTGGAAGAAGAAAGCGGCGGCGAACCGACCACCTACAGCAACAGCTTTGAGGTCATCAGC
GCCAAAACCACCTGGCGTGCGGACCTGCCGTACAAGCCGATGGTCGATGGCCCGCAGATTGCGACAGTGG
TGGGGCCGGCCGGTGAAGAAATCTACTGTGACGAATACGGCCGCATCAAGCTGCAATTCCCGTGGGACCG
CTACGGGGCGAGTGACGACCAGAGCTCCTGCTGGGTGCGGGTGAGTCAGGGCTGGGCGGGCGGCCAGTAC
GGGCTGATAGCCATCCCGCGCATCGGCCATGAAGTGATTGTCAGCTTCCTCGAAGGCGACCCGGACCAGC
CGATAGTGACCGGCAGGACCTTTCATGCGACTAACCGCCCTCCTTATGAGTTGCCCACCCACAAGACGCG
TACCGTTCTTCGTTCAAGAACGCATAAAGGAAAAGGCTTTAACGAACTGCGCTTTGAAGATCAGTCTGGA
CAGGAAGAAGTATTTATCCACGCCCAGAAGGACATGAACACCGTGGTGCTCAATAACCGCAGCACAAAGG
TGAACATCGACCACAGTGAAAATGTGGGTCGTCATCAGACAATCATGGTTGGCGAAAATCAGGGAACAGA
AATCAGAGGCACCCAGAGGATTACGGTGGAAAAGGGCCGCAAGACCGAAATCACCACGACTGAAGAGCTG
ACCGTAACCGGAGATATTACCGTGCTGTCAGCCAGCGGCACGATCAAATTATCTACCGCTGGTGGATATA
TCTCTATTGATAATGCTGGCGATATCAACATTGTCGGCAACCACCTGATGCTAAATGGCGTACGCATCGA
TTTGAACCAGTAG