SecReT6
Effector Protein ID: 470156394
-
SecReT6 ID649
T6SS typeA1
Gene symbol-
Locus tagW5S_3961
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]4278202..4280940 [+]
ProductRhsF
Effector typeProtein
Homologous effectorDda3937_02773
DescriptionRhsB
UniProt IDK4FMP7
KEGG IDpec:W5S_3961
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 55..81
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 90..123
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 108..143
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 150..166
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 172..209
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 237..274
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 262..295
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 302..337
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 343..376
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 373..396
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 383..412
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 442..457
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 472..482
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 502..538
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 523..558
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 565..587
RHS_repeat [PF05593], Evalue: 3.30E-52, Aligned region: 603..631
DNase_NucA_NucB [PF14040], Evalue: 8.70E-32, Aligned region: 810..911
DUF4595 [PF15283], Evalue: 1.60E-06, Aligned region: 85..131
DUF4595 [PF15283], Evalue: 1.60E-06, Aligned region: 188..188
DUF4595 [PF15283], Evalue: 1.60E-06, Aligned region: 236..280
DUF4595 [PF15283], Evalue: 1.60E-06, Aligned region: 271..299
DUF4595 [PF15283], Evalue: 1.60E-06, Aligned region: 361..442
DUF4595 [PF15283], Evalue: 1.60E-06, Aligned region: 495..533
DUF4595 [PF15283], Evalue: 1.60E-06, Aligned region: 570..612
RHS [PF03527], Evalue: 0.00074, Aligned region: 64..77
RHS [PF03527], Evalue: 0.00074, Aligned region: 128..142
RHS [PF03527], Evalue: 0.00074, Aligned region: 268..280
RHS [PF03527], Evalue: 0.00074, Aligned region: 696..714
Protein Sequence: 912 a.a.     [Download]
>gi|470156394|ref|YP_006284896.1| RhsF [Pectobacterium sp. SCC3193]
MDGDHQGRCIYTTCADGYLTANFEYLADRVVMIDGLGQRHEYGFNDLYLMAWEKSPLGHLTRYEYDDVGN
LLREISPAGRAVEFAYLGDSGLVSTFTDGSGHAWHYAYDDHERLIGITDPLGRRWVWQYDNNGNPLSLTG
PDASEMRFAWNRYGLLTEVSDQNGHVQASLFYDHRQRLLSATDAEARTQQLRYDQQDRLTTWTRPDGATY
RLGYRRASWRLPEQLIRPDEKEEKRQYDKHNNLLNYTDGNGAVWQQTYGPFDLLTSRTDAEGRTWQYDYD
KDSQQLIGVTAPDGNRWQWWLDADGRVIRERDMAGTETHYGYDEDGHCISVRNGEGEIRHFLYDGRGLLI
KETAPDDTLYYRYDAAGRLTDVTSTTSHVQLEYDERDRVVQEHNSGTAIRRHYQDASHTVTRSLHWEGEE
DSAALTSTFCYRATGELHQVQLPDGAALTLAHDGAGRESSRQSQAGFMQHREYDAMGWLTREMSGQTVDG
RLQPVQTREYLYDGAGNLTGTRRNREAAGYRLDASGRVLSVLSGGAGRTVNTEEEYRYTRSGLPQDATRL
TDWQAGRLTQQDNTHYQYDKAGRLIRRQVVQPGYRPQVWHYRWDSRNQLRVVDTPTGERWLYRYDPFGRR
IGKRCDQTQDDIRYLWDGDQIAEVRHSRDNQLVSRRHWVHNGWELLVQQRQNADASWETDFVTSGHNGEP
QAVFNPQGELRWQAPRANLWGQRYTENAEKYDPGLAFAGQYRDDESGLCYNRFRYYDPSGGCYISPDPIG
IAGGDNNYGYVYNPVSWVDPFGLAGCSLIKSSSKDYDYILKLKRTEYPQTFGHIDDAIGKGHPDIVTINR
GTAKSNRKVSLKDVKTKTGYDRDEWPMAMFKEGGNGASVRYINPSDNRGAGSSIGNILSDLPDGTRIKVE
IL
-
Nucleotide Sequence: 2739 bp     [Download]
>gi|470152509|ref|NC_017845.1|:4278202-4280940 Pectobacterium sp. SCC3193, complete genome
ATGGATGGCGACCATCAGGGACGCTGTATCTACACCACCTGTGCCGATGGCTACCTGACGGCGAATTTCG
AGTACCTGGCTGACCGCGTGGTGATGATTGACGGGCTGGGACAGCGCCATGAATACGGCTTCAACGACCT
GTACCTGATGGCGTGGGAAAAATCTCCGCTCGGCCATCTCACCCGCTATGAGTATGACGATGTGGGCAAC
CTGCTGCGGGAAATTTCCCCGGCGGGTCGGGCAGTGGAATTTGCCTATCTGGGCGACAGCGGGCTGGTCA
GCACCTTTACCGACGGCAGCGGCCACGCGTGGCACTACGCCTATGACGACCACGAGCGACTTATCGGTAT
TACCGACCCGCTGGGGCGCCGTTGGGTCTGGCAGTACGACAATAACGGCAACCCGCTGAGTCTGACCGGG
CCGGATGCGAGCGAAATGCGGTTTGCCTGGAACCGCTACGGCCTGCTGACCGAAGTGAGCGACCAGAATG
GACACGTGCAGGCCAGCCTGTTTTACGACCACCGTCAGCGCCTGTTGAGCGCCACCGATGCGGAAGCCCG
CACTCAGCAACTGCGCTACGACCAGCAGGACAGACTGACCACCTGGACACGCCCGGATGGTGCCACCTAT
CGGCTGGGTTATCGCCGGGCAAGCTGGCGACTGCCGGAGCAACTGATACGCCCGGACGAGAAAGAGGAAA
AACGCCAGTACGACAAGCATAACAACCTGCTGAACTACACCGACGGCAACGGTGCGGTCTGGCAGCAAAC
CTACGGCCCGTTCGACCTGCTGACTTCACGCACCGACGCTGAAGGCCGCACCTGGCAGTACGACTATGAT
AAAGACAGTCAGCAACTGATTGGTGTCACCGCCCCGGATGGCAACCGCTGGCAGTGGTGGCTGGATGCGG
ACGGACGGGTTATCCGTGAGCGGGACATGGCCGGTACGGAAACCCACTACGGCTATGACGAAGACGGGCA
CTGCATCAGCGTGCGCAATGGCGAAGGGGAAATCCGCCACTTTCTGTACGACGGGCGCGGCCTGCTTATC
AAAGAAACCGCGCCGGACGATACGCTGTATTACCGCTATGATGCGGCCGGTCGACTGACCGACGTGACAT
CGACCACCAGTCATGTCCAGCTTGAATATGACGAGCGTGACCGGGTGGTACAGGAGCATAACAGCGGCAC
GGCAATCCGACGCCACTATCAGGACGCATCGCACACCGTTACCCGCAGCCTGCACTGGGAAGGCGAAGAG
GACAGCGCGGCACTGACCAGCACCTTCTGCTACCGCGCCACGGGCGAACTGCATCAGGTGCAGTTGCCGG
ACGGCGCAGCACTGACGCTGGCTCACGACGGTGCGGGTCGTGAGTCTTCCCGGCAGAGTCAGGCTGGCTT
TATGCAGCACCGTGAATACGATGCCATGGGCTGGCTGACGCGGGAGATGAGCGGGCAGACGGTAGACGGT
CGCCTGCAGCCGGTACAGACGCGGGAATACCTCTACGATGGCGCGGGTAACCTGACGGGCACCCGACGCA
ACCGCGAAGCGGCAGGTTACCGACTGGATGCCAGCGGACGGGTGCTGTCGGTACTGAGCGGTGGTGCGGG
GCGCACCGTCAACACCGAAGAGGAATACCGCTACACCCGCAGCGGGCTGCCGCAGGATGCGACAAGGCTG
ACCGACTGGCAGGCCGGACGCCTGACCCAGCAGGACAACACTCACTATCAGTACGACAAGGCCGGGCGGC
TCATTCGCAGGCAGGTGGTGCAACCGGGCTATCGGCCACAGGTGTGGCACTACCGCTGGGACAGCCGCAA
CCAGTTGCGGGTAGTGGACACGCCGACCGGTGAGCGCTGGCTCTACCGTTACGACCCGTTCGGGCGGCGC
ATTGGCAAACGCTGCGACCAGACCCAGGACGATATCCGTTACCTGTGGGACGGCGACCAGATAGCGGAGG
TGCGGCACTCTCGCGACAATCAACTTGTCTCACGGCGCCACTGGGTGCACAACGGCTGGGAACTGCTGGT
GCAGCAGCGCCAGAACGCCGACGCAAGCTGGGAAACCGACTTTGTGACCAGCGGTCATAATGGCGAACCG
CAGGCGGTCTTTAATCCGCAAGGCGAACTGCGCTGGCAGGCTCCGCGCGCTAATTTATGGGGCCAGCGCT
ATACGGAAAACGCTGAAAAATATGATCCGGGGCTGGCATTTGCCGGACAATACCGTGACGACGAAAGTGG
CTTATGCTATAACCGTTTCAGGTATTATGACCCGAGCGGTGGTTGTTATATCTCGCCTGACCCGATAGGG
ATAGCGGGGGGAGATAATAACTATGGGTATGTGTATAACCCTGTCAGTTGGGTTGATCCGTTTGGGTTGG
CGGGATGTTCCTTAATAAAATCATCCTCCAAGGATTATGATTACATCTTAAAGTTGAAGCGTACTGAATA
CCCGCAAACATTTGGTCATATTGATGACGCTATTGGGAAAGGTCATCCAGATATCGTGACTATCAATAGA
GGAACGGCCAAGTCAAATAGGAAAGTGAGTTTAAAAGATGTAAAGACAAAGACTGGGTATGATCGTGACG
AATGGCCAATGGCTATGTTTAAAGAGGGCGGAAATGGTGCAAGTGTCAGGTATATTAATCCTAGCGATAA
TCGCGGCGCCGGCTCAAGCATTGGTAATATTTTGTCGGATTTACCTGATGGAACTAGAATTAAAGTGGAG
ATTTTATAA