SecReT6
Effector Protein ID: 470156842
SecReT6 ID650
T6SS typeA3
Gene symbol-
Locus tagW5S_4426
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]4780530..4782566 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDK4FN48
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-70, Aligned region: 30..328
Phage_GPD [PF05954], Evalue: 2.30E-70, Aligned region: 489..588
Phage_base_V [PF04717], Evalue: 7.70E-23, Aligned region: 367..459
Protein Sequence: 678 a.a.     [Download]
>gi|470156842|ref|YP_006285344.1| VgrG protein [Pectobacterium sp. SCC3193]
MANSTGLQFTVKVGALPASTFVVVDFQLSEALNRPFSLSLSLASALPDVDFGAVLDQPCELMIWYEGELK
RRVSGIISGFTQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEEAGITDYAFSLRHD
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGEYV
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSSELAHQRESYQHYDYPGRYKQDPSGKAFSNYQLDAL
RSEAVTSQGESNCAGLMPGRRFTLTEHPNATLNAVWQTVSVTHIGQQPQALEEESGGEPTTMSNSFEVIS
AKKNWRAIMPYKPMVDGPQIATVVGPTGEEIYCDQYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GMIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPTPYVLPAHKTRTTLRTDTHKGSGFNELRFEDEAT
REQIYYHAQKDMDGVINNIHRQSVGRDQHLTVAQDQFQRVERHRHRTIGKDDFENIGQDHHQEIGRSFIQ
KIGSSFKRFIGGGEVTQIEGSRQTTMSGSEETLIGAHQHVLVNTDSYLKAADIVLEAGQALTIKAPGGFI
KIDSAGVTISGTIVKINDGGAAGVGTAPVSVTPEDPTKPTLPDAPDRR
-
Nucleotide Sequence: 2037 bp     [Download]
>gi|470152509|ref|NC_017845.1|:4780530-4782566 Pectobacterium sp. SCC3193, complete genome
ATGGCCAACAGTACAGGATTGCAGTTCACTGTAAAGGTCGGCGCGTTGCCGGCCTCGACGTTTGTGGTGG
TCGATTTTCAGCTCAGCGAGGCGCTTAACCGGCCTTTCAGCCTATCGCTGAGTCTGGCCAGCGCCCTGCC
GGATGTGGATTTTGGCGCGGTGCTGGACCAGCCGTGCGAGCTGATGATTTGGTATGAGGGTGAGCTAAAG
CGTCGGGTCAGCGGGATTATCAGTGGTTTCACACAGGGCGACACCGGTTTTCGCCGCACCCGCTATCAGG
CGGAAGTGCGCCCGGCGCTGTGGCGGCTGGGCTTACGTACCAACGCCCGCATCTTTCAGGCGCAGAAGCC
AGAGGCGATTATCGGCACCCTGCTGGAAGAAGCCGGGATTACCGACTACGCCTTCTCGTTACGTCATGAC
CATGCCCCGCGTGAATACTGCGTGCAGTACCGGGAAAGTGATTTGGCGTTTGTCACCCGACTGGCCGCAG
AGGAAGGCCTGTACTTCTTCCACGAATTTGAGGAAGGCAAACACCGGGTGGTCTTTGCCGACGATGCCGG
CGCATTGGCCAAAGGCCCTGAGTTGTTCTTCAATTTGGCGACACAGGGGCTGAGTGAGGGCGAATATGTC
CGGCGTTTCCACTATGCCGAGCGGGTGAGTACGGCAGAAGTGGAATTGAAAGATTACAGTTTCAAAACAC
CAGCTTACGGGCTGTCACACAAGAAGATGAGCAGCGAACTGGCGCACCAACGTGAAAGCTATCAGCATTA
CGACTATCCAGGGCGTTATAAACAAGATCCGAGCGGCAAAGCGTTCAGCAACTACCAGTTGGATGCACTG
CGTTCAGAGGCGGTGACAAGCCAAGGGGAATCGAACTGCGCGGGGCTGATGCCGGGCCGTCGCTTCACGT
TAACCGAACATCCGAATGCAACGCTGAATGCAGTGTGGCAAACGGTGAGCGTGACGCATATCGGGCAGCA
GCCACAGGCGCTGGAAGAAGAAAGCGGCGGCGAGCCAACGACCATGAGCAACAGTTTTGAAGTTATCAGT
GCAAAAAAAAACTGGCGAGCCATCATGCCGTACAAACCCATGGTGGATGGCCCACAGATTGCCACGGTGG
TAGGGCCGACTGGCGAAGAAATCTACTGTGACCAGTACGGCAGGATCAAACTGCAATTCCCGTGGGACCG
CTACGGCGCAAGTGATGACCAAAGCTCCTGCTGGGTGCGAGTGAGTCAGGGCTGGGCGGGCGGCCAGTAC
GGCATGATAGCCATCCCGCGCATCGGCCATGAAGTGATTGTCAGCTTCCTCGAAGGTGACCCGGACCAGC
CGATTGTCACCGGCAGAACCTTTCATGCGACTAATCCAACACCGTATGTTTTACCGGCACATAAAACGCG
TACAACACTTCGTACCGATACACATAAAGGCAGCGGCTTCAACGAACTGCGCTTTGAAGATGAGGCAACG
CGTGAACAAATTTATTACCACGCGCAGAAAGATATGGATGGTGTCATCAACAACATCCACCGACAGAGCG
TGGGGCGCGATCAGCATCTCACCGTGGCTCAGGATCAGTTCCAACGCGTCGAACGCCACCGTCACCGCAC
GATAGGCAAGGATGATTTTGAAAACATCGGTCAGGATCATCATCAGGAAATTGGCCGGAGTTTTATTCAG
AAGATAGGTTCTTCATTCAAACGCTTCATCGGCGGAGGAGAAGTTACCCAAATCGAAGGGAGTCGTCAGA
CCACGATGTCCGGGTCTGAAGAGACACTGATCGGCGCACACCAGCATGTCCTGGTGAATACGGACAGCTA
TCTGAAAGCCGCAGACATTGTGCTGGAAGCGGGACAAGCTCTGACGATTAAAGCGCCTGGCGGTTTTATC
AAGATTGATAGCGCGGGTGTCACAATTTCCGGGACGATTGTGAAAATCAACGATGGCGGTGCGGCTGGCG
TGGGGACAGCGCCCGTGTCGGTTACGCCAGAAGATCCTACGAAGCCCACCCTGCCAGATGCGCCAGACAG
ACGTTAA