SecReT6
Effector Protein ID: 470463469
SecReT6 ID739
T6SS typeA4b
Gene symbol-
Locus tagETAC_11495
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2606310..2606867 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEvpP
Description
UniProt IDM4U1T4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 185 a.a.     [Download]
>gi|470463469|ref|YP_007629780.1| hypothetical protein ETAC_11495 [Edwardsiella tarda C07-087]
MSILNSELDWSHVGSISTGQGTVVSDAFKISYGLPTKELLPAGTALYKFNGRFSLAKPPITDDTPLSPWW
SPVQPFRHDGGLQQRMLVAKLNGVSMREWGRLTSVIKENWSSLDFLLEIVLKVPVYAWFGGFKGMSRIDE
DKPSLRNIALEQKGRGSNLPGGATQFYIPNLTVGHISSHNFSTLK
-
Nucleotide Sequence: 558 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2606310-2606867 Edwardsiella tarda C07-087, complete genome
ATGTCGATTTTGAATTCTGAGCTGGACTGGTCCCATGTCGGGAGTATTTCTACAGGCCAAGGCACCGTCG
TCAGTGATGCATTTAAAATATCCTATGGACTGCCGACGAAAGAGCTGCTTCCGGCGGGAACAGCCTTATA
CAAATTCAATGGACGTTTTTCATTGGCAAAGCCCCCGATCACTGACGATACCCCGCTGTCTCCCTGGTGG
AGCCCGGTCCAACCATTCCGCCACGATGGCGGTCTGCAGCAGCGTATGCTGGTCGCTAAGCTAAACGGCG
TATCAATGAGGGAGTGGGGACGACTCACCTCCGTCATCAAAGAAAACTGGAGTTCTCTCGACTTTTTACT
TGAGATAGTCCTAAAGGTTCCCGTCTATGCCTGGTTTGGGGGATTTAAGGGCATGTCGCGTATTGATGAA
GATAAACCCTCTCTACGGAATATCGCGTTGGAACAAAAAGGCAGGGGATCGAACCTCCCCGGCGGGGCCA
CACAGTTCTATATTCCAAACCTGACGGTTGGGCATATCAGTAGCCACAACTTTTCAACCTTGAAATAA