SecReT6
Effector Protein ID: 470463472
SecReT6 ID739
T6SS typeA4b
Gene symbol-
Locus tagETAC_11510
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2609186..2609677 [+]
Producttype VI secretion system protein EvpC
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDM4TJX3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-35, Aligned region: 6..137
Protein Sequence: 163 a.a.     [Download]
>gi|470463472|ref|YP_007629783.1| type VI secretion system protein EvpC [Edwardsiella tarda C07-087]
MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVTKWMDCASVKL
ASAAVQGQNFPTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSDRPQETIDFAYKEVTWEYVPQ
DQNGKAGGKIGPEGWSLITNKKK
-
Nucleotide Sequence: 492 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2609186-2609677 Edwardsiella tarda C07-087, complete genome
ATGGCTTTTGATACTTATATCAAACTGGATAAGGTTGATGGGGAATCCACCGACGATAAGCACAAAAAAT
GGATTGAAGTGCTGGGTTTTGCCTGGGGCGCGGGCAATGAATGCACGATGGAGAGCGGCACCCAGGGGCT
GAATACCGGTAAGGCGATGATGTCGGTGCTGCGTGTCACCAAATGGATGGACTGCGCCAGTGTCAAGCTG
GCCTCCGCCGCCGTGCAGGGGCAGAACTTTCCCACGCTGGAGCTGGAGATTTGCACCCAGGCGGGCGATA
AGTTCGCCTTCTGCATCTACAAATTTACGCATGTCGCCGTCTCCAGCTATCAATGCTCAGGGGCCACGGG
CGGCAGCGATCGCCCGCAGGAAACCATTGATTTTGCTTATAAAGAAGTGACATGGGAATACGTTCCCCAG
GATCAGAACGGCAAGGCGGGCGGCAAAATTGGTCCTGAGGGCTGGAGCCTTATTACCAACAAGAAAAAGT
AA