SecReT6
Effector Protein ID: 470479726
-
SecReT6 ID741
T6SS typeA1
Gene symbol-
Locus tagPCNPT3_08470
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]2004770..2005288 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDM4U8Y3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-33, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|470479726|ref|YP_007640470.1| type VI secretion system effector [Psychromonas sp. CNPT3]
MPTPCYISIEGKTQGNITAGSFTSDSVGNIYVEGHEDEMLVQAFDHIVTVPTDPQSGQPSGQRIHKPFKF
TVALNKSVPLMYNALASGEMLPKIDLKWYRTSVEGKQEHFFSTILTDATIIDINCQMPHCQDVTKADFTQ
LITVSVSYRAINWDHKISGTSGSDDWRKPISA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|470478036|ref|NC_020802.1|:2004770-2005288 Psychromonas sp. CNPT3, complete genome
ATGCCAACTCCTTGCTATATTTCAATCGAAGGTAAAACTCAGGGTAATATTACTGCGGGTTCATTTACAT
CTGACTCTGTCGGTAATATTTATGTCGAAGGTCATGAAGATGAGATGTTAGTGCAAGCATTTGATCATAT
TGTAACTGTACCAACAGATCCTCAATCCGGTCAACCTTCGGGTCAACGCATCCACAAACCATTCAAATTT
ACTGTCGCATTAAATAAATCAGTCCCATTGATGTATAACGCATTGGCGTCTGGTGAAATGTTGCCAAAAA
TAGATCTTAAATGGTATAGAACATCAGTTGAAGGTAAACAAGAACATTTCTTTTCAACTATATTAACAGA
TGCAACAATTATCGACATAAACTGTCAAATGCCCCATTGTCAAGATGTAACAAAAGCTGATTTCACCCAA
CTTATAACTGTTTCTGTATCATATCGAGCCATTAATTGGGATCATAAAATATCAGGAACATCTGGATCTG
ACGATTGGCGCAAACCTATATCTGCATGA