SecReT6
Effector Protein ID: 471315941
hcp
SecReT6 ID737
T6SS typeA1
Gene symbolhcp
Locus tagHCBAA847_1435
StrainHelicobacter cinaedi ATCC BAA-847
Repliconchromosome [GenBank: NC_020555] [Browse all T6SS(s) in this replicon]
Location [Strand]1384826..1385341 [+]
Productsecreted protein
Effector typeProtein
Homologous effectorHH0243
DescriptionHcp protein
UniProt IDI7H5C9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-37, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|471315941|ref|YP_007601296.1| secreted protein [Helicobacter cinaedi ATCC BAA-847]
MAQPAYIKIEGSTQGLISSGASTEASIGNRYQAGHEDEIMAQEVAHIVTVPTDPQSGQPSGQRVHKPFSF
TCSLNKAVPLLYNALTSGERLTSVEIHWFRTSTSGGQEHYFTTKLEDAIITDINLVMPNAQEQNNSDKTE
LFKVSLNYRKVIWEHIAAGTSGSDDWRETKV
-
Nucleotide Sequence: 516 bp     [Download]
>gi|471314537|ref|NC_020555.1|:1384826-1385341 Helicobacter cinaedi ATCC BAA-847 DNA, complete genome
ATGGCACAACCAGCCTATATAAAAATTGAGGGTTCTACTCAAGGACTTATTTCAAGTGGAGCTTCCACAG
AAGCGAGTATTGGAAATCGTTACCAAGCAGGACACGAAGACGAGATTATGGCACAAGAAGTTGCTCATAT
TGTAACCGTTCCAACAGACCCACAAAGCGGACAACCATCAGGGCAAAGAGTGCATAAGCCTTTTTCTTTT
ACCTGTTCTTTAAATAAGGCTGTTCCTCTGCTTTATAATGCACTCACAAGCGGGGAGAGATTAACAAGTG
TAGAAATTCATTGGTTTAGAACTTCTACAAGTGGGGGACAAGAGCATTATTTCACAACAAAATTAGAAGA
CGCTATTATTACAGATATTAATCTTGTAATGCCTAATGCACAAGAACAAAACAATAGCGATAAAACAGAG
CTTTTTAAAGTTTCTCTCAATTATAGAAAAGTGATTTGGGAGCACATTGCCGCAGGGACAAGTGGAAGTG
ATGATTGGAGAGAAACTAAAGTTTAA