SecReT6
Effector Protein ID: 472323962
-
SecReT6 ID743
T6SS typeA1
Gene symbol-
Locus tagH681_03930
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]848040..848558 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDM4WV74
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-39, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|472323962|ref|YP_007656208.1| hypothetical protein H681_03930 [Pseudomonas denitrificans ATCC 13867]
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQVLVQAFNHQVIIPRDPQSGQPTGQRVHKPLMI
TKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVIVDVQSRMPNCQDPNMAHFTH
LEDVYFTYRKIVWTHEVSGTSGSDDWRTPISA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|472323176|ref|NC_020829.1|:848040-848558 Pseudomonas denitrificans ATCC 13867, complete genome
ATGCCAACACCCGCGTATCTGTCCCTCGAAGGCACCAAGCAAGGCCTGATCACCGCCGGCACCTTCACCG
AGGACTCGGTCGGCAACATCTTCCAGGAAGGTCACGAAGACCAGGTTCTGGTTCAGGCCTTCAACCACCA
GGTCATCATTCCGCGTGACCCGCAGTCCGGCCAGCCGACCGGTCAGCGCGTGCACAAGCCGCTGATGATC
ACCAAGGTTTTCGACAAGTCCTCGCCGCTGATCTTCAACGCCCTGACCTCCGGCGAGCGTCTGAACAAGT
GCCGCCTGGAGTGGTACCGCACCTCCTCCACCGGTACCCAGGAGCACTACTTCACCATCGAGCTGGAAGA
TGCGGTGATCGTCGACGTGCAGTCGCGCATGCCGAACTGCCAGGACCCGAACATGGCGCACTTCACTCAC
CTGGAAGACGTCTACTTCACCTACCGCAAGATCGTCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCG
ACGACTGGCGCACCCCGATCTCTGCCTGA