SecReT6
Effector Protein ID: 478476296
-
SecReT6 ID746
T6SS typeA3
Gene symbol-
Locus tagG655_00480
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]110538..111920 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0093
DescriptionTse6
UniProt IDM9RYT2
KEGG IDpsg:G655_00480
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.60E-15, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 6.60E-15, Aligned region: 78..153
PAAR_motif [PF05488], Evalue: 6.60E-15, Aligned region: 292..302
DUF4150 [PF13665], Evalue: 0.0064, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.0064, Aligned region: 125..146
DUF4150 [PF13665], Evalue: 0.0064, Aligned region: 348..374
Protein Sequence: 460 a.a.     [Download]
>gi|478476296|ref|YP_007706947.1| hypothetical protein G655_00480 [Pseudomonas aeruginosa B136-33]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQDTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAA
KAEIDAVADGLAAKHGGRVAKAPIKSRERAMQKINNDYKGDPTKIKDLARNTIIVEGDKVNTVAAELANR
GAKVKVIDGNADPLGYSGVNSTMNTKAGIPGEIQVNSPEMIYAKESEDMARILLGNDTYDAVAAKAGVPG
GQGHKYYEDWRVLDPKSPEAQAIAEKSRAYYDAVRKGNGN
-
Nucleotide Sequence: 1383 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c111920-110538 Pseudomonas aeruginosa B136-33, complete genome
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCG
CCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGTTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACA
GTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCAACGGCAAGCCGGCGGCGCGC
CTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGGACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGTTGGAGTGGTCGCCATC
GGCGGCCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCG
ACCTGTTCCAGGGCGTGGCCGGCATGGCGCTGCTGGGCTTCGGACCGAAGATGGCACGGCTCGGCAACGC
ACCCAAGGGCGCGCCGAAGACCCAGGTGCCGAAAGGCTTCGAGAAGGTCTATGGCAAGGCGCCGGCAGCC
AAGGCCGAGATCGACGCGGTGGCCGACGGACTGGCGGCGAAGCACGGCGGCAGGGTCGCCAAGGCACCGA
TCAAGTCGCGCGAACGCGCCATGCAGAAGATCAACAACGACTACAAGGGCGATCCGACCAAGATCAAGGA
TCTGGCCCGCAACACCATCATCGTCGAAGGCGACAAGGTGAACACCGTTGCCGCCGAGCTGGCCAACCGC
GGCGCCAAGGTCAAGGTGATCGACGGCAACGCCGACCCGCTCGGCTACAGCGGGGTGAACTCGACGATGA
ACACCAAGGCCGGGATACCCGGCGAGATCCAGGTCAACTCGCCGGAGATGATCTACGCCAAGGAGTCGGA
GGACATGGCTCGCATCCTCCTCGGCAACGACACCTACGACGCGGTGGCGGCCAAGGCCGGCGTACCCGGA
GGGCAGGGCCACAAGTACTATGAGGACTGGCGGGTACTGGATCCGAAGTCCCCGGAGGCCCAGGCCATCG
CCGAGAAGAGCCGGGCGTACTACGACGCAGTGAGGAAAGGCAATGGCAATTGA