SecReT6
Effector Protein ID: 478477653
-
SecReT6 ID746
T6SS typeA3
Gene symbol-
Locus tagG655_07275
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]1575648..1578947 [-]
Productphospholipase D
Effector typeProtein
Homologous effectorPA3487
DescriptionPldA
UniProt IDM9RYZ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 4.60E-17, Aligned region: 165..189
PLDc [PF00614], Evalue: 4.60E-17, Aligned region: 852..877
PLDc_2 [PF13091], Evalue: 5.20E-09, Aligned region: 155..183
PLDc_2 [PF13091], Evalue: 5.20E-09, Aligned region: 808..894
Protein Sequence: 1099 a.a.     [Download]
>gi|478477653|ref|YP_007708304.1| phospholipase D [Pseudomonas aeruginosa B136-33]
MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDYFSDLASALDS
ASSSIFITGWQVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWLSPSGSLGTYDFETMLAVFQLNAGL
EGGARAFCTPAIQQSDMQGLGVALSHHQKSVVIDNRIGYVGGIDLAYGRRDDNDFSLDASGRRGNDAYNP
GLPHLGWMAEDEHVSSMGLMMATLFDLSRPLASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRARALN
GAAYLSDLFRSPMLPSLQWLGRAYNSSKEGLDEGFERLDALRRQMVASSIRAIANLIADNLDALPIEPEL
ERRLRAWLEELRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKGFEDIPQNLSGKAGELAGSLF
WTLHRLLQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPSVYDLARNFIDRWNG
QQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRNLRLELDPPTPCWINAPEQLPQEPE
VRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQVGVSTEGVQSNCKDAMLLAISGAQQFIYIENQFF
QSEFGKEGEVFKDLPLSGPMASLRDVGSLRRDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQF
LKSMLAMWGVNAQGWLTHKLGEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVPNIMH
QVHLTQQSLVFGEQSLVKRIQRQMALKALEGKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLNLRTW
AVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQGERDSELAVMVRDSEPLTVRLDGKNDAIVGK
AIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAIQTLAKENTRAYERTFNFIPQNISQ
TQLQLTPEPPKGFEVGFPASIWPTWAYRKPGELRAGGQLMEPMPYQEIFWRSSNLTSVKTFPPPNGVSGF
ITALPTSWTRGERNDSGLNLSILAHQDSRSLPTQVAMNGDSSAQGKHRT
-
Nucleotide Sequence: 3300 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c1578947-1575648 Pseudomonas aeruginosa B136-33, complete genome
ATGTTGCAGAAGAAGCCCTACAACGGCCTCCACGAAAAGGAACTCAACCAGATCAACCAGCAGGATGGCA
GCCCCTGCGTAGCCATTTCCGCACCGGGCTGTTTCATCAAGGGGTCCAACCTCTTTTCCGAAAAGCGGGC
CGGTAACCGGGTCCGCTTCTTCACCACCGGCCGGGACTACTTCAGCGACCTGGCCAGCGCCCTCGACAGC
GCCAGTTCGAGCATCTTCATCACCGGCTGGCAGGTCAACTACGACGTCCTCCTCGACGGCCGCCGCAGCC
TCTGGCAGTGCCTGCGCCAGGCGCTGGAGCGCTCGCCCGCGCTGAAGGTCTACGTGATGCCCTGGCTCAG
CCCTTCCGGCAGCCTCGGCACCTATGACTTCGAAACCATGCTCGCGGTGTTCCAGCTCAACGCCGGACTC
GAGGGCGGCGCGCGCGCCTTCTGTACGCCGGCGATCCAGCAGAGCGACATGCAGGGACTGGGCGTCGCCC
TCTCCCACCACCAGAAATCCGTGGTGATCGACAACCGCATCGGCTATGTCGGCGGGATCGACCTTGCCTA
TGGCCGTCGCGACGACAACGATTTCAGCCTCGACGCCTCCGGGCGCCGGGGCAACGACGCCTATAATCCC
GGCCTACCGCATCTTGGCTGGATGGCGGAGGACGAACACGTCAGCTCCATGGGCCTGATGATGGCCACCC
TGTTCGACCTTTCCAGGCCGCTCGCCAGCCTGACGCTGCATGCGCCCACCCTTCGCCTGTCGCCCTTCCC
GCACATCGCCGCCAGCGACGAACCGCTGCTGAGCATTCCCCTCGCACCCAGCCGCGCCCGCGCCCTCAAC
GGCGCCGCCTACCTTTCCGACCTGTTCCGCAGCCCGATGCTGCCCTCCCTGCAATGGCTCGGCCGCGCCT
ACAACAGCTCGAAAGAAGGCCTGGACGAAGGCTTCGAACGGCTCGATGCACTCAGGCGGCAGATGGTCGC
CAGCAGCATCCGCGCCATTGCCAACCTGATCGCCGACAACCTCGACGCCCTGCCCATCGAGCCTGAACTC
GAACGCCGCCTGCGCGCCTGGCTGGAGGAACTGCGCACGGCCGCGCTCAACCTGCCGGAAGCCCTGCGGA
TCAAGAGCCTGCTCCTGATCAACCAGTGGATGAGCGAAACCGAACTGGGCCAGGTCCTGACCCTGATCAG
CGGCAAGGGCTTCGAAGATATCCCGCAGAACCTGAGCGGCAAGGCCGGCGAGTTGGCCGGCTCGCTGTTC
TGGACACTCCACAGACTGTTGCAGGCCCGCGCCGGAGGCCACCAGCAACCCTATCGCTACCTGGACGAAG
CGCCTCAGCCATTGGCCTCGCCGGACAACGCCCGGCTGGCCGCCGACCAGCCGCGCATGCCCTGGCAGGA
TGTGCATTGCCGCATCGAAGGGCCGTCGGTGTACGACCTGGCGCGCAACTTCATCGACCGCTGGAACGGC
CAGCAGGCCTACCTGGCCAAGACGCCGGCGCTACAGGATACGGCGCTGGTACGCAGCGCCCTGGAAGCCG
TGATGAAGTGGCTGAACAGCCTGGCCGCCGCCGCGGGATTGGAGAACTACCTGGACGAGAAGCGCAACCT
CCGGCTCGAACTGGACCCACCCACGCCCTGCTGGATCAACGCGCCGGAACAGTTGCCGCAAGAGCCGGAG
GTGCGCCGCGGCGGCATGACCGTACAGGTACTGCGCAGCGCCGCGGCGCGCATGCTCGAACAGGAGCAGG
CCGGCCGCCTCGGCGCGGGAGTGAACCTGCCCTTGCAGGTCGGCGTCTCCACCGAAGGAGTCCAGAGCAA
CTGCAAGGACGCCATGCTCCTGGCGATTTCCGGGGCGCAGCAGTTCATCTATATCGAGAACCAGTTCTTC
CAGAGCGAGTTCGGCAAGGAAGGCGAAGTTTTCAAGGATCTGCCCCTTTCAGGCCCCATGGCCAGTCTGC
GCGACGTTGGCAGCCTGCGACGCGACTTCGTCGTCCGGATACGCTTGGAGGAAGCCCTGGAGCAGCGCGA
CCTCTGGCTGCTGGACTGGGCCGAAGTGGAGAAGATCGCCCAGGAGCCTGGCACCGAGGCCCGCCAGTTC
CTCAAGTCGATGCTCGCCATGTGGGGCGTGAACGCCCAGGGCTGGCTCACCCACAAGCTCGGCGAGGCCC
AGCACGGCCTGCTCAACGAGATCGGCGAAGCCCTGGCGCGGCGCATCGAACGGGCCATCCAGCGCGAGCA
CCCGTTCCACGTCTACCTGGTCCTGCCGGTGCACCCGGAGGGCGCGCTGAACGTGCCGAACATCATGCAC
CAGGTGCACCTGACCCAGCAGAGCCTGGTGTTCGGCGAACAGAGCCTGGTCAAGCGCATTCAGCGGCAGA
TGGCGCTCAAGGCCCTGGAAGGCAAGTCCGACCCGGCCCAGGCCCGGGAAATCATCGAGCGCAAGGACGC
TCGCGGTCGCCCGGTCTACGAACAGCAGGACTGGAGCCGCTACCTGACCCTGCTCAACCTGCGCACCTGG
GCGGTGCTCGGCGGGCGGGTGGTCACCGAACAGATCTACGTGCACAGCAAGCTGCTGATCGCCGACGACC
GGGTGGCCATCCTCGGCAGCGCCAATATCAACGACCGCAGCCTGCAAGGCGAGCGCGACTCCGAGCTGGC
GGTGATGGTGCGCGACAGCGAGCCGCTGACGGTCAGGCTGGACGGCAAGAACGACGCCATCGTCGGCAAG
GCCATCCACCAGTTGCGGGTGAATTTGTGGAAGAAGCATTTTGGCTTGAGCCAGGGGCCAGGCGGTTTCG
TCAAGCCGGCCAGCGAGTTGAGTGCTTATCTGTCCATCCCGGCGGCTCAAGAGGCCTGGGAAGCTATACA
AACATTAGCCAAGGAGAATACTCGTGCCTATGAACGGACTTTCAATTTTATTCCCCAAAATATCAGCCAG
ACTCAACTGCAACTGACTCCAGAGCCGCCTAAAGGATTTGAGGTCGGATTTCCCGCCTCCATATGGCCAA
CCTGGGCATACAGAAAACCTGGCGAGTTAAGGGCGGGCGGACAACTGATGGAGCCGATGCCATATCAGGA
AATCTTCTGGCGCTCATCTAATCTCACTTCGGTGAAAACCTTCCCACCACCCAACGGGGTTTCCGGTTTC
ATCACGGCTCTACCAACCAGTTGGACCCGTGGTGAGCGCAATGATTCCGGCTTGAATCTAAGCATCCTGG
CACATCAGGACAGCAGATCGCTTCCCACCCAGGTCGCCATGAATGGAGATAGCTCGGCACAAGGAAAGCA
TCGCACATGA