SecReT6
Effector Protein ID: 478478491
-
SecReT6 ID746
T6SS typeA3
Gene symbol-
Locus tagG655_11475
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2454296..2454772 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2702
DescriptionTse2
UniProt IDM9S509
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 158 a.a.     [Download]
>gi|478478491|ref|YP_007709142.1| hypothetical protein G655_11475 [Pseudomonas aeruginosa B136-33]
MSYDYEKTSLTLYRAVFKANYDGDVGRYLRPDQELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDG
LYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQL
DNFVRNAIRRQWEKARGL
-
Nucleotide Sequence: 477 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c2454772-2454296 Pseudomonas aeruginosa B136-33, complete genome
ATGTCCTACGACTACGAGAAAACCAGCCTCACCCTCTACCGGGCGGTATTCAAGGCCAACTACGACGGCG
ACGTCGGTCGCTACCTGCGCCCCGACCAGGAACTCGCCGAGGCTGCGGAAGTCGCCCCGCTGCTGCATCC
GACCTTCGACAGCCCCAACACCCCTGGCGTCCCCGCCCGCGCGCCGGACATCGTCGCCGGCCGCGACGGC
CTCTACGCCCCGGACACCGGCGGCACCTCGGTGTTCGACCGCGCCGGCGTGCTGCGCCGCGCCGACGGCG
ACTTCGTGATACCCGACGGCACCGACATCCCGCCGGACCTTAAGGTGAAACAGGACAGCTACAACAAGCG
CCTGCAAGCCACCCACTACACCATCATGCCGGCCAAGCCGATGTACCGGGAGGTCCTCATGGGCCAACTG
GACAACTTCGTGCGCAACGCCATCCGCCGCCAATGGGAAAAAGCCCGCGGGCTCTAG