SecReT6
Effector Protein ID: 478478507
-
SecReT6 ID746
T6SS typeA3
Gene symbol-
Locus tagG655_11555
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]2472467..2474536 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDM9S0A0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-86, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 4.80E-86, Aligned region: 346..397
Phage_base_V [PF04717], Evalue: 5.30E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 1.90E-08, Aligned region: 514..528
Gp5_C [PF06715], Evalue: 1.90E-08, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 1.90E-08, Aligned region: 529..551
Gp5_C [PF06715], Evalue: 1.90E-08, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 1.90E-08, Aligned region: 553..575
Gp5_C [PF06715], Evalue: 1.90E-08, Aligned region: 605..615
Gp5_C [PF06715], Evalue: 1.90E-08, Aligned region: 620..634
DUF2345 [PF10106], Evalue: 4.50E-05, Aligned region: 645..683
Protein Sequence: 689 a.a.     [Download]
>gi|478478507|ref|YP_007709158.1| hypothetical protein G655_11555 [Pseudomonas aeruginosa B136-33]
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSR
RYFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRER
DHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIE
AIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCI
DAGQAFRPLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSVQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAERNQDIEVENDETHWIGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVD
RNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVS
VGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2070 bp     [Download]
>gi|478476202|ref|NC_020912.1|:2472467-2474536 Pseudomonas aeruginosa B136-33, complete genome
ATGCTGTTCTCCCAACACACCCGCCTGGTACACGTGGACTCCCCGCTGGGCCCCGAGGTCCTGCAACTGC
AACGGCTGGAGGGTCGCGAAGAGCTGGGCCGGCTGTTCAGCCACGAGCTCGAACTGGTCTCGAGCAATCC
CGCCTTGCCTCTGGATGCCCTATTGGGCAAGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGCAGCCGG
CGGTATTTCCACGGCATCGTCGCGCGCTGTAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGGCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGTGTGCAATACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTGGTTCCGCCACGAAAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGG
CGCGCACCACAGCCCGGCCGGCTACACCAGCGTGCCCTATTACCCGCCGAGCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCACATGGCGCGCGAGGTCCAGCCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCACCCGCCTGGAAGTGCGTTCGAATGTCGGCCGCGCCCATGCCGCGGCCGACTACCC
GCTCTACGACTACCCTGGCGAGTATGTGCAGAGCCAGGATGGCGAACACTATGCGCGGACCCGCATCGAG
GCGATCCAGACCCAGTACGAGCGAGTTCGCCTGCGGGGATGCGCCAGGGGCATCGGGGCGGGCCACCTGT
TCCACCTGAGCAACTACCCGCGTCTCGACCAGAACCGCGAATACCTGGTGGTCGGCGCCGAGTACCGGGT
GGTCCAGGAACTCTACGAGACCGGCAGTGGTGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGTATC
GATGCCGGCCAGGCCTTCCGCCCCTTGCCGCAGACCCCGGTGCCGGTGGTGCGCGGCCCGCAGACCGCGG
TGGTGGTGGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTATGGCCGGGTCAAGGTGCATTTCCACTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGGTGCAGATCCCACGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGATCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGAC
CGCAACGAGACGGTCAGGATCGGCATGAACAAGACGGAAACCATCCTCATGGCCTCGTTGCAGAACGTCG
GCATGGGGCGCATGGAAAACGTCGGGCTCGGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTGGT
CGGGCTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGC
GTGGGCGGCAGCGACGATGGCTCGAAGATCACCCTGGACGGTCAGAGCATCACCCTCGGCAGCCAGCGCA
TCGAGCTGACCGCCGACCGCGAGATCCTCTTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGA
GATCGAGATCCTCTCGCCCAATGTCGATATCAACTGTTGA