SecReT6
Effector Protein ID: 478481538
-
SecReT6 ID747
T6SS typeA4a
Gene symbol-
Locus tagG655_26795
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]5881685..5883922 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDM9S9X5
KEGG IDpsg:G655_26795
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 303..329
PLDc [PF00614], Evalue: 1.20E-06, Aligned region: 640..661
PLDc_2 [PF13091], Evalue: 3.00E-06, Aligned region: 56..117
PLDc_2 [PF13091], Evalue: 3.00E-06, Aligned region: 281..332
PLDc_2 [PF13091], Evalue: 3.00E-06, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 3.00E-06, Aligned region: 635..687
Protein Sequence: 745 a.a.     [Download]
>gi|478481538|ref|YP_007712189.1| hypothetical protein G655_26795 [Pseudomonas aeruginosa B136-33]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARTRIAELEAENAEIQRTLDSSG
AQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDGERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEQKGVT
PKVEQRLGGLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVVVATLATSDPAPGSPPPGRLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHSDSELGIAQPNPDLARAMREELWGLHAYEVAATT
KDNFELWNQTMDKNWKQQRNDEPLTSHLLRFWDVITPYSPSFTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c5883922-5881685 Pseudomonas aeruginosa B136-33, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTGTACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCTTTCTACCCGCCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCGATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGCTTCAAACGCCCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGAGTGCAGGCGCGAGTGCTGGTCTGGAGCAACCAGCTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCAGTG
GACAACGAGGTGCTGCGGCTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAGCGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGACGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGGG
GCCCAGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGACCGGTGATGAACGGCGAGCAAGTGCGCCTCGTCAATGGGCGGCTGCAAAGCCTGATCCAC
CTGTTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAAGTCCAGGGACCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGAACCCAGCCA
CAGGACGGCGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAAGCGCTCGAACAGAAAGGCGTGACG
CCGAAAGTCGAGCAACGCCTCGGCGGTCTTGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTCGCCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
CGACCCTGCCCCCGGCAGCCCGCCGCCAGGGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCACCG
CCGCTGAAGGCGCGCTACAAGCACATCTACGTGCACTCCAAGCTGCTGCTGGTGGACGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATAGCGACAGCGAGTTGGGGATTGCCCAGCCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGGACTACATGCGTATGAAGTGGCTGCAACAACC
AAGGACAACTTTGAACTTTGGAATCAAACAATGGACAAGAACTGGAAACAGCAGCGAAACGATGAACCTC
TCACTAGCCATCTATTACGGTTCTGGGATGTCATAACACCTTATAGCCCGAGCTTTACGGTGGATTAA