SecReT6
Effector Protein ID: 479273322
-
SecReT6 ID752
T6SS typeA2
Gene symbol-
Locus tagENC_31190
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]3152480..3152971 [+]
Producttype VI secretion system effector, Hcp1 family
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD6DXJ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-36, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|479273322|ref|YP_007846601.1| type VI secretion system effector, Hcp1 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MAIPAYLWLKDDGGADIKGSVDVQDREGSIEITGFSHNLSIPTDLMTGKITGTRKHSAVLIQKEFDSSSP
YLYKAVATGQTLKSAEFKWYKINDAGQEAEYFNILLESVRVVGVSPVMHDTKDPTKEKHNHLECVELRYE
KITWKYCDGNVQFTDAWNERAQA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|479270911|ref|NC_021046.1|:3152480-3152971 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGCTATTCCAGCTTACCTATGGCTTAAAGATGACGGTGGCGCAGATATTAAAGGGTCTGTAGATGTTC
AGGATCGTGAGGGCAGCATTGAGATCACTGGATTTTCCCATAATCTCAGCATTCCAACGGACTTAATGAC
TGGAAAGATCACAGGAACCCGCAAGCACTCTGCCGTGCTAATTCAAAAAGAGTTTGATAGCTCCTCCCCT
TATCTTTATAAAGCTGTTGCTACTGGTCAGACGCTTAAATCTGCTGAGTTCAAATGGTATAAGATCAACG
ACGCAGGACAGGAAGCGGAATACTTCAACATCCTGCTTGAAAGTGTGAGAGTTGTCGGCGTTTCTCCAGT
GATGCACGACACCAAAGATCCGACCAAAGAGAAGCACAACCACCTCGAGTGTGTAGAACTTCGCTATGAA
AAAATCACGTGGAAATACTGCGATGGCAACGTTCAGTTTACCGATGCATGGAATGAGAGAGCGCAAGCGT
GA