SecReT6
Effector Protein ID: 482904191
-
SecReT6 ID757
T6SS typeA3
Gene symbol-
Locus tagSTU288_08260
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. U288
Repliconchromosome [GenBank: NC_021151] [Browse all T6SS(s) in this replicon]
Location [Strand]1700356..1700724 [+]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDM9XL36
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NLPC_P60 [PF00877], Evalue: 9.10E-05, Aligned region: 23..95
CHAP [PF05257], Evalue: 0.00011, Aligned region: 17..88
Protein Sequence: 122 a.a.     [Download]
>gi|482904191|ref|YP_007902751.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
MSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|482902549|ref|NC_021151.1|:1700356-1700724 Salmonella enterica subsp. enterica serovar Typhimurium str. U288, complete genome
ATGAGTTGGGATAAAAGAATGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCACAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA