SecReT6
Effector Protein ID: 488603078
-
SecReT6 ID758
T6SS typeA4b
Gene symbol-
Locus tagBTI_493
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]528603..529106 [+]
Producttype VI secretion system effector, Hcp1 family protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDN0A7I8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-44, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|488603078|ref|YP_007917012.1| type VI secretion system effector, Hcp1 family protein [Burkholderia thailandensis MSMB121]
MLHMHLKFGNPAIKGESADKDHAGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSP
LLYQHASGGTTFDEVTIDFLRADGEGERVKYLEIKLKYVIISSIAPSVQNEGLPIETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|488601775|ref|NC_021173.1|:528603-529106 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGTTACACATGCATCTGAAGTTCGGTAATCCGGCCATCAAAGGCGAGTCCGCAGACAAGGACCACGCCG
GCTGGATCGAACTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCGTCGACCGCGGG
CGGCCATACGGCAACGCGTTGCGAACACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCG
TTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAGGTGACGATCGATTTCCTGCGCGCCGACG
GCGAAGGCGAGCGCGTTAAGTATCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCAGAACGAAGGCCTGCCGATCGAGACCTTCTCGCTGAAGTACGCGGCGGTCCAGTGGAAGCAGACT
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTAA