SecReT6
Effector Protein ID: 488603274
-
SecReT6 ID758
T6SS typeA4b
Gene symbol-
Locus tagBTI_2773
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]3056143..3058926 [-]
ProductRhs element Vgr family protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDN0AI56
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-56, Aligned region: 45..377
DUF2345 [PF10106], Evalue: 7.10E-42, Aligned region: 617..645
DUF2345 [PF10106], Evalue: 7.10E-42, Aligned region: 698..849
T6SS_Vgr [PF13296], Evalue: 1.60E-37, Aligned region: 562..670
T6SS_Vgr [PF13296], Evalue: 1.60E-37, Aligned region: 741..801
Phage_base_V [PF04717], Evalue: 2.80E-14, Aligned region: 456..545
Protein Sequence: 927 a.a.     [Download]
>gi|488603274|ref|YP_007919242.1| Rhs element Vgr family protein [Burkholderia thailandensis MSMB121]
MSLNGTLRSFAAGAVDWNNRPIALNFGRLQSTLGPLLALQHAGIREALMTGIHGHLTCVSTRHDLSPRLF
LGVPVSLRLVTDRGQLRFINAIVKDVQIGQSDGELCIYQLTVCDALSLMDKRTNSRVFRKTSVVDVLAVL
LNEWRRRSPALAAAFEFDLSGLDRSRYPARELTRQVNESDAKFVRRLLRREGINVFAKAGPATPPRNIHD
ETPVHTLVFCDNPLQLPEAPAGTVRLHPRDAATEQRDTITLFALHQQLISGQASRPSWDYKQGRVHDSAA
TASIDQGEAGNDLANLLTDVAIDIPHVGDSWDDHDRITRDRMLAHQFDAERYDGVSSVRDMPVGHWFTLT
GDVDLDMQPAEKRQFMITSVHHEVWNNLPKGLTGRVHALFAASRNLTQAAPALPAALEAESDTRYENVFT
CVRRGVPLTPAYDPKIDLPPVHLLTGVIVTRSGEEVVCDELGRVYVQIQGLDAGDHAHAQGAGTNGNAGD
SAPIRVASSLAGAGFGVTFLPRAGMEVLLGCIAGDPDRLVILCVLGNGVNTPATFTHTGSLPGNRFVSGI
KTQEIKGRKYNQLRLDDTPQQISAQLASEHAHTQLNLGYLTQPRNNGVGQDRGEGAELRTDAAAALRAAQ
GILLTTYARSQASGGQLDRDELLQLLGECTELFKSLGDYAGQHGGQAADTAGQTAVAQAFKGWTPGSGTS
NSGDAAGGSQALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRFNATAGQGMQLFARGTGV
QAVAGEGPMLLQAQADTLTANAQKGVKIATNENEVLVTAPTIRFVAEDGSYIKIGDGVTLGTNGDIKLLS
ASHQWGGPSTEQASKTSFTNQPTDQQFRLHFHGHTPETPALAANQQYRIALNDGRIIEGKSDASGLTDLV
KDDVMRIAKIDILKPSL
-
Nucleotide Sequence: 2784 bp     [Download]
>gi|488601775|ref|NC_021173.1|:c3058926-3056143 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
GTGTCATTAAATGGAACACTACGCAGTTTCGCGGCGGGGGCCGTCGACTGGAACAATCGGCCGATCGCGC
TGAATTTCGGCCGACTGCAAAGTACCTTGGGACCGCTCTTGGCCCTTCAGCACGCGGGCATTCGCGAAGC
GCTGATGACCGGCATCCACGGGCACCTGACCTGTGTGTCGACGCGTCACGACCTGTCGCCCCGGCTATTC
CTTGGCGTGCCCGTCTCTCTGCGGCTTGTCACCGATCGCGGCCAGCTCCGCTTCATCAACGCGATTGTCA
AGGACGTGCAGATCGGCCAGAGCGACGGCGAGCTGTGCATCTACCAGCTTACGGTGTGTGACGCGCTGTC
GCTGATGGACAAGCGCACCAATTCGCGCGTGTTCCGCAAGACGAGCGTCGTCGACGTGCTGGCGGTCCTG
TTGAACGAATGGCGGCGCCGTAGCCCGGCGCTCGCGGCGGCGTTCGAGTTCGACCTGTCCGGCCTCGACC
GGAGCCGTTATCCGGCGCGCGAGCTGACCCGGCAGGTCAACGAGTCGGACGCGAAGTTCGTGCGCCGGCT
GCTGCGCCGCGAGGGCATCAACGTGTTCGCGAAAGCCGGTCCCGCGACGCCGCCGCGCAACATTCATGAC
GAGACGCCCGTCCATACGCTCGTGTTCTGCGACAACCCGCTGCAATTGCCGGAGGCCCCGGCGGGCACGG
TGCGCCTGCACCCGCGCGACGCCGCGACCGAGCAGCGCGACACGATCACGCTGTTTGCTCTGCATCAGCA
ACTGATTTCCGGGCAGGCGAGCCGGCCGTCGTGGGACTACAAGCAGGGGCGCGTCCACGATTCGGCAGCG
ACCGCGAGTATCGATCAGGGCGAAGCCGGCAACGACCTTGCGAACCTGCTGACGGACGTGGCGATCGACA
TTCCGCATGTCGGCGATTCGTGGGACGATCACGATCGCATTACGCGCGACCGGATGCTTGCGCATCAATT
CGACGCCGAGCGCTACGACGGCGTAAGCAGTGTGCGGGATATGCCGGTCGGCCACTGGTTCACGCTGACC
GGCGATGTCGATCTCGACATGCAGCCGGCCGAGAAACGGCAGTTCATGATCACGTCGGTGCATCACGAGG
TCTGGAACAATCTGCCGAAGGGCTTGACGGGGCGCGTCCACGCGTTATTTGCCGCGAGCCGCAATCTGAC
GCAGGCTGCACCCGCATTGCCGGCCGCGCTCGAGGCGGAATCGGACACCCGCTACGAGAACGTGTTCACC
TGCGTGCGGCGCGGCGTTCCGCTCACGCCCGCGTACGATCCGAAGATCGACCTGCCGCCCGTCCATCTGC
TCACGGGCGTGATTGTGACGCGCAGCGGCGAGGAAGTCGTGTGCGACGAACTTGGCCGGGTCTACGTGCA
GATACAGGGACTCGATGCGGGCGATCACGCGCATGCGCAGGGCGCAGGCACCAACGGCAATGCGGGCGAC
AGTGCCCCGATCCGGGTGGCATCCAGTTTGGCCGGGGCGGGCTTCGGCGTAACGTTCTTGCCGCGCGCCG
GCATGGAGGTTCTGCTGGGCTGTATCGCGGGCGATCCCGACCGTTTGGTGATTCTCTGTGTGCTCGGAAA
CGGCGTGAACACGCCCGCGACGTTCACTCATACCGGCTCGCTGCCGGGCAACCGTTTCGTGTCGGGAATC
AAGACGCAGGAAATCAAGGGCCGGAAATATAACCAGCTCCGTCTCGACGATACGCCGCAGCAGATAAGTG
CTCAACTTGCGAGCGAACACGCGCATACGCAATTGAATTTGGGTTATCTGACCCAGCCGCGCAACAACGG
CGTCGGACAGGATCGCGGCGAAGGCGCGGAACTGCGCACGGACGCGGCCGCGGCACTGCGGGCAGCGCAG
GGCATTCTGCTGACGACCTATGCGCGCTCGCAGGCGAGCGGCGGCCAGCTCGATCGCGATGAATTGCTGC
AATTGCTCGGCGAGTGCACCGAACTCTTCAAGTCGCTCGGCGACTACGCCGGACAGCACGGCGGGCAGGC
GGCAGATACGGCAGGCCAGACCGCCGTCGCGCAGGCGTTCAAGGGCTGGACGCCGGGGAGTGGCACATCG
AATTCCGGCGATGCGGCAGGCGGTTCGCAGGCGCTGATGGCGTTCGGGGCGCAGGCCGGGTCGGTGAACG
TGACGCCGAAGACGCACGTAACGTATGCGGGCGAGAACATCGATCAGGTGGCGCAGCAGCATCTTCAGTT
GATGAGCGGTCAGCGCTTTAATGCGACGGCCGGACAGGGAATGCAGTTGTTCGCGCGCGGCACTGGCGTA
CAGGCCGTGGCCGGTGAGGGGCCGATGTTGCTGCAGGCGCAGGCCGACACCCTGACGGCGAATGCTCAGA
AGGGCGTCAAGATCGCGACGAATGAGAACGAGGTGCTTGTCACCGCACCGACGATCCGGTTCGTTGCCGA
AGACGGCAGTTATATCAAGATCGGCGATGGCGTGACGCTCGGCACGAACGGTGACATCAAGTTGCTGTCG
GCGTCGCACCAGTGGGGCGGGCCGTCGACGGAGCAGGCTTCGAAAACGTCCTTCACGAACCAGCCGACCG
ACCAGCAGTTCCGTTTGCACTTTCATGGGCATACGCCGGAAACACCGGCGCTGGCGGCTAACCAGCAATA
TCGCATCGCGCTCAACGACGGGCGGATTATTGAAGGCAAGTCCGATGCCAGTGGGCTGACGGATCTGGTG
AAGGACGACGTGATGCGCATCGCCAAGATCGATATCTTGAAGCCGTCGCTCTGA