SecReT6
Effector Protein ID: 488604541
-
SecReT6 ID758
T6SS typeA4b
Gene symbol-
Locus tagBTI_59
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021173] [Browse all T6SS(s) in this replicon]
Location [Strand]75134..75574 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDN0AFG5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|488604541|ref|YP_007916594.1| hypothetical protein BTI_59 [Burkholderia thailandensis MSMB121]
MPYVSTHYSSNADAPVGRWTCAPTSKLAPFDKAPSGSVTSGRDLCGQCVSYVKRVCPTLPLTAQWRKGTA
VKGNASIVAGTVIATFNAAGKYDGHAAIYVSQSKDGGILVYDQFVTPPTPQPVQQRRLRWGAHGRSNNGD
NFYVVE
-
Nucleotide Sequence: 441 bp     [Download]
>gi|488601775|ref|NC_021173.1|:c75574-75134 Burkholderia thailandensis MSMB121 chromosome 1, complete sequence
ATGCCTTACGTCTCCACCCATTATTCGAGCAATGCCGACGCGCCGGTCGGCCGCTGGACCTGCGCGCCCA
CGTCGAAGCTCGCGCCATTCGACAAGGCGCCGTCCGGCAGCGTTACGTCCGGCCGCGATCTCTGCGGGCA
ATGCGTGTCGTACGTGAAACGGGTCTGCCCGACGCTGCCGCTCACCGCGCAGTGGCGCAAGGGCACGGCG
GTGAAGGGGAACGCGTCGATCGTCGCGGGCACCGTGATCGCGACGTTCAACGCGGCCGGCAAGTACGACG
GCCACGCGGCCATCTACGTCAGCCAGTCGAAGGACGGCGGCATCCTCGTCTACGACCAGTTCGTCACGCC
GCCCACGCCGCAACCGGTTCAGCAACGGCGCCTGCGCTGGGGCGCGCATGGCCGGTCGAACAACGGAGAC
AATTTTTATGTCGTGGAGTAA