SecReT6
Effector Protein ID: 488606046
-
SecReT6 ID758
T6SS typeA4b
Gene symbol-
Locus tagBTI_4974
StrainBurkholderia thailandensis MSMB121
Repliconchromosome I [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]1710765..1711670 [-]
ProductD-mannose binding lectin family protein
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDN0APP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 2.40E-10, Aligned region: 37..45
B_lectin [PF01453], Evalue: 2.40E-10, Aligned region: 88..134
B_lectin [PF01453], Evalue: 2.40E-10, Aligned region: 177..230
PQQ_2 [PF13360], Evalue: 0.0058, Aligned region: 23..102
PQQ_2 [PF13360], Evalue: 0.0058, Aligned region: 198..223
Protein Sequence: 301 a.a.     [Download]
>gi|488606046|ref|YP_007921421.1| D-mannose binding lectin family protein [Burkholderia thailandensis MSMB121]
MKKIALALLLMLFSSMSAMAGAIIPSGGTLVAGQYAISNNGNFAFGIDAASGKLYFHYKFPTQAWGASSM
SQIYGTKPEGALYVGTGDRLVMQTDGRLAFYSGNDVVWSNWYYGPAPIPGSYAVVEDFGVVAIYPPQGGY
PSFTWPFASVTPNSGALATVIGYPFGLNFPVLNGRQSLQIFNNVTYYLWNKSFASDSVAMQPDGNLVVYN
KGQPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGILANVPYPVSVDQPSRASGPNDPKPTPATPPPPSLNL
PINASWKCYYVKDWLVCYAPG
-
Nucleotide Sequence: 906 bp     [Download]
>gi|488605303|ref|NC_021174.1|:c1711670-1710765 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGAAAAAAATCGCATTGGCGCTCTTGTTGATGCTGTTTTCATCGATGTCGGCAATGGCGGGGGCGATCA
TTCCATCGGGCGGCACACTGGTCGCGGGGCAATACGCGATATCGAACAACGGCAACTTCGCATTCGGCAT
CGACGCCGCGAGCGGCAAGCTCTATTTCCACTACAAGTTCCCGACGCAGGCATGGGGCGCGAGCTCGATG
TCGCAAATCTACGGAACGAAACCCGAGGGCGCGCTTTACGTGGGCACGGGCGACCGGCTCGTGATGCAGA
CCGACGGCCGGCTCGCTTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGGCCCGCGCC
CATTCCGGGCTCATACGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGCTAT
CCTTCGTTCACCTGGCCGTTCGCATCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTCATCGGCTATC
CGTTCGGCCTGAACTTCCCGGTGCTCAACGGACGCCAATCGCTGCAGATCTTCAACAACGTCACCTATTA
CCTGTGGAACAAGAGCTTTGCGTCGGACAGCGTCGCGATGCAGCCCGACGGCAATCTCGTCGTCTACAAC
AAGGGGCAGCCGGTCTGGTCGACGGGAACCTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCCGTCG
GCTTCGTTCTCGGCAAGCAGTATGGCGGCATCCTCGCGAACGTGCCGTATCCGGTGTCCGTCGACCAGCC
GAGCCGCGCGAGCGGTCCGAACGATCCGAAGCCGACGCCGGCCACGCCGCCGCCGCCTTCGCTGAACCTG
CCGATCAACGCGAGCTGGAAGTGCTATTACGTCAAGGACTGGCTCGTGTGCTACGCGCCGGGCTGA