SecReT6
Effector Protein ID: 488655078
-
SecReT6 ID763
T6SS typeA3
Gene symbol-
Locus tagTY21A_13130
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]2665434..2665835 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY0300
DescriptionTae2_TY
UniProt IDN0BZ66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|488655078|ref|YP_007926881.1| hypothetical protein TY21A_13130 [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MPYVYANAKALQDTEKVGNHHQCVELIQHYIRVGQASTWQQGAAVFGNKNIEVGTVIATFVNGRYPNHNS
GNHAAFFLGQDTGGIWVMDQWKDDIAKPRVSKRYIRKLHNGSVRSDGTYIRMSNNAEAYFIVE
-
Nucleotide Sequence: 402 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c2665835-2665434 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGCCATATGTTTATGCTAATGCAAAGGCTTTACAGGATACAGAAAAGGTAGGAAACCACCATCAGTGTG
TTGAACTTATTCAACACTATATACGAGTAGGACAAGCGAGTACATGGCAGCAAGGGGCCGCAGTATTTGG
AAACAAAAACATTGAAGTCGGGACAGTTATCGCTACTTTTGTGAATGGGCGATATCCGAACCACAATAGT
GGCAACCATGCTGCATTTTTTTTGGGGCAAGATACTGGCGGGATATGGGTGATGGATCAATGGAAAGATG
ATATCGCAAAACCCCGTGTGTCCAAACGTTATATAAGAAAGTTGCATAATGGAAGTGTTCGTAGTGACGG
GACTTATATAAGGATGAGTAATAATGCAGAAGCCTATTTTATCGTTGAATAG