SecReT6
Effector Protein ID: 488655514
-
SecReT6 ID763
T6SS typeA3
Gene symbol-
Locus tagTY21A_15415
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty21a
Repliconchromosome [GenBank: NC_021176] [Browse all T6SS(s) in this replicon]
Location [Strand]3132317..3132802 [-]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDN0BYY4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|488655514|ref|YP_007927317.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty21a]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIKWQITAEKS
DGAQQESRASVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|488652559|ref|NC_021176.1|:c3132802-3132317 Salmonella enterica subsp. enterica serovar Typhi str. Ty21a, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGTGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCAAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAACAGGAGTCCAGAGCGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA