SecReT6
Effector Protein ID: 50083347
-
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD0053
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]55985..56617 [+]
Productzinc protease
Effector typeProtein
Homologous effectorACIAD0053
DescriptionTpe1 (ACIAD0053),is predicted to contain a zinc metallopeptidase active site,PS00142.
UniProt IDQ6FFX2
KEGG IDaci:ACIAD0053
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|50083347|ref|YP_044857.1| zinc protease [Acinetobacter sp. ADP1]
MGLNIIENNLDKIITNNKNDSLAKLKLRTRLLTLGEIELCRLVYKNSIDYSRVTIIEGSFFPLDLQNEDT
FVTPNGHIFIPTKHFLLDYSTASLSYKHLFIHEMGHVWQHQRKNNVLINAGIAQACTIFKDPYKYNIHGA
DTVADYVKYKNTKKFVNYNLESQAEIFADYWALKTNNIHVISKKNISNIDKSNLDTTLAIYEEKISEVIK
-
Nucleotide Sequence: 633 bp     [Download]
>gi|50083297|ref|NC_005966.1|:55985-56617 Acinetobacter sp. ADP1 chromosome, complete genome
ATGGGATTAAATATTATTGAAAATAATTTAGATAAAATAATCACGAATAATAAAAATGATAGTTTAGCTA
AGTTAAAGCTAAGAACACGTTTATTAACACTGGGGGAAATTGAACTATGCAGATTAGTTTATAAAAATAG
TATTGATTATTCTAGAGTTACTATTATAGAGGGAAGCTTTTTTCCATTGGATTTACAAAATGAAGATACT
TTTGTTACTCCTAATGGACATATTTTCATTCCAACTAAGCATTTTCTATTAGATTATAGTACTGCTAGTC
TAAGCTATAAGCATCTATTTATTCATGAAATGGGGCATGTTTGGCAACATCAAAGAAAAAACAATGTACT
TATAAATGCTGGGATAGCACAAGCATGTACTATTTTTAAAGATCCATATAAATATAATATTCATGGTGCA
GATACTGTAGCTGATTATGTAAAATATAAGAATACCAAAAAGTTTGTTAATTATAATTTAGAGTCCCAAG
CAGAAATTTTTGCAGACTACTGGGCATTAAAAACCAATAATATTCATGTAATTAGCAAAAAAAACATATC
TAATATAGATAAAAGTAATTTAGATACCACACTGGCAATTTATGAAGAAAAAATAAGCGAAGTGATTAAG
TAG

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature