SecReT6
Effector Protein ID: 50083453
-
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD0168
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]170197..172380 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorACIAD0168
DescriptionTae1 (ACIAD0168)is a peptidoglycan-hydro- lyzing amidase by bioinformatic analysis.
UniProt IDQ6FFL6
KEGG IDaci:ACIAD0168
PDB IDNA
Domain hit(s) vs Pfam LysM [PF01476], Evalue: 1.2e-13, Aligned region: 112-155
Hydrolase_2 [PF07486], Evalue: 3.0e-06, Aligned region: 579-690
Protein Sequence: 727 a.a.     [Download]
>gi|50083453|ref|YP_044963.1| hypothetical protein ACIAD0168 [Acinetobacter sp. ADP1]
MNKKSLVTIQLLDLFGSPISKAQYEVKNQRTGQVIAAGFTNSSGCIVEISRDKGTALDVYIKSMFNGLMI
KIQSFVMFKDRMLVKITSPKVMLDLKTLTNQGDNGQYKRKTHVVKKGETLFEIAQKNHTTVRALERLNKI
DDPNKISIGQVIKLPVNIPATGNNSHQEKAKQTTQQRTQPSASSTKTKAPQTPPTRPSSITPQKKQEEGI
FGANFGSKILDQVNELYEEGKKTLNEATNAASKILTVDDRSQDGGTPKADAPNLCKTNPQCISSGKSELI
REVNIRLAGFGGALPTDEFTELTANCIKQFQRDYMGVPETGKICGSVLVALDKFYEEYPIAGFMGKAACN
CGKCSGFGNGNMGVPSGSNKANEYPGLHRSLIWILKAINFYLKNEFKEKKIEVAYIESGYRCIENNKKHG
RATVNHMGLALDIHFNKNGRRTREVNDMEFIRKQIMVKKMGASESREVDKIYLEPKVFNSGTSGATTWVH
FDVTKFSAIYFSGNIFQKTIVELNGVKMFTLVNSLKVPRILSCGGGGSTQKPHDTIVGGELVLSNDDIID
IMKVTETEVIKFKTEKYFTDQAAGVVDTIMNRVKSGVWGDSIRSVVNADRQFSKITGPKSLDPYGSVEKM
PISHVSTRIRNFVNSYLIERANGKLSIIGENLNYANKYYSDAKNRKAWVDKFHDEAVKKGMILGNGTAIH
AHGTTTELRNKMPKPFKIVLPKNFKGI
-
Nucleotide Sequence: 2184 bp     [Download]
>gi|50083297|ref|NC_005966.1|:170197-172380 Acinetobacter sp. ADP1 chromosome, complete genome
GTGAATAAAAAATCACTAGTTACGATACAACTCTTAGATTTATTTGGTAGTCCAATCTCAAAAGCACAAT
ATGAAGTAAAAAATCAGAGGACTGGGCAAGTTATTGCTGCTGGATTTACGAATTCGTCTGGATGTATCGT
TGAGATTAGTCGAGATAAAGGTACGGCTTTAGATGTTTATATCAAAAGTATGTTTAATGGCTTGATGATC
AAGATACAAAGTTTTGTAATGTTTAAAGATCGCATGCTCGTAAAAATTACCAGTCCAAAAGTAATGTTGG
ATTTAAAAACATTAACAAATCAAGGTGATAATGGACAATATAAAAGAAAAACGCATGTTGTAAAAAAGGG
TGAAACTTTATTTGAAATAGCTCAAAAAAATCATACTACTGTTCGAGCATTAGAGCGTTTGAATAAAATA
GATGACCCTAATAAGATTAGTATTGGGCAAGTGATTAAGTTGCCAGTGAATATTCCTGCGACAGGAAATA
ATTCACATCAAGAAAAAGCGAAACAGACCACTCAGCAGAGAACACAACCTTCGGCTAGCAGCACTAAAAC
AAAAGCACCACAGACTCCGCCTACAAGGCCATCGAGTATAACACCTCAGAAAAAGCAGGAAGAAGGAATT
TTTGGAGCAAATTTTGGCAGTAAAATCCTCGACCAAGTGAATGAGCTTTATGAAGAAGGTAAAAAAACGC
TGAATGAAGCTACAAACGCTGCTTCCAAAATATTGACGGTTGATGATCGCAGTCAGGATGGTGGGACACC
TAAAGCAGATGCTCCAAATTTATGTAAAACTAATCCGCAATGTATTTCAAGTGGTAAGAGTGAGCTTATT
CGAGAAGTAAATATTCGTTTAGCAGGCTTCGGTGGAGCTTTACCTACGGATGAGTTTACCGAACTGACTG
CAAATTGTATTAAGCAATTCCAACGGGATTATATGGGGGTACCAGAGACGGGGAAAATTTGTGGTTCAGT
ATTGGTAGCGTTGGATAAATTTTATGAAGAATACCCTATTGCAGGTTTTATGGGGAAAGCTGCTTGTAAT
TGTGGCAAATGTTCGGGCTTTGGTAATGGTAATATGGGGGTTCCATCTGGTTCAAATAAAGCAAATGAAT
ATCCAGGATTACACCGAAGTCTAATCTGGATATTAAAGGCTATAAATTTTTATTTAAAAAATGAATTTAA
GGAAAAGAAAATCGAAGTAGCTTATATAGAGTCTGGTTATAGATGTATTGAAAATAATAAAAAACATGGA
AGAGCAACAGTAAATCATATGGGTTTAGCTCTGGATATTCATTTTAATAAGAATGGACGTAGGACTCGTG
AAGTCAATGATATGGAATTTATTCGTAAACAAATTATGGTTAAAAAAATGGGAGCATCTGAAAGTAGAGA
GGTTGATAAAATTTATTTAGAACCAAAAGTTTTTAATAGTGGGACTTCAGGAGCAACTACATGGGTACAT
TTTGATGTTACTAAATTCTCAGCTATATATTTTAGTGGAAATATTTTTCAAAAAACAATAGTTGAATTAA
ATGGCGTTAAAATGTTTACTCTAGTAAACAGCTTGAAAGTTCCTAGGATTTTAAGTTGTGGAGGGGGGGG
CTCAACACAAAAACCACATGATACTATAGTGGGGGGTGAACTAGTACTAAGTAATGATGATATTATAGAT
ATTATGAAAGTAACTGAGACTGAGGTGATAAAGTTTAAAACAGAGAAATATTTTACTGATCAAGCTGCTG
GTGTTGTAGATACTATTATGAATAGAGTCAAGTCTGGTGTATGGGGGGATAGTATCAGAAGTGTAGTTAA
TGCTGATAGACAGTTTTCTAAAATTACAGGTCCTAAAAGTTTAGACCCTTATGGTAGTGTTGAAAAAATG
CCAATATCGCATGTAAGTACAAGGATTAGGAATTTTGTTAATAGCTATCTTATAGAAAGAGCAAATGGTA
AACTTTCCATTATTGGAGAAAATCTAAACTATGCAAATAAATATTATTCAGATGCAAAAAATAGAAAGGC
ATGGGTAGATAAATTTCATGATGAAGCGGTCAAGAAAGGTATGATACTTGGCAATGGAACAGCTATACAT
GCTCATGGCACTACGACTGAATTAAGAAATAAAATGCCAAAACCTTTTAAAATAGTTCTCCCTAAAAACT
TCAAAGGAATTTAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature