SecReT6
Effector Protein ID: 50086118
-
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD3114
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]3040392..3043397 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorACIAD3114
DescriptionTse2 (ACIAD3114) is a homolog of the Tse3AB (ACX60_11695) in A.baumannii ATCC 17978,and leads to a low-level permeabilization of E. coli.
UniProt IDQ6F809
KEGG IDaci:ACIAD3114
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1001 a.a.     [Download]
>gi|50086118|ref|YP_047628.1| hypothetical protein ACIAD3114 [Acinetobacter sp. ADP1]
MNKYNVLEYSIIFYDQRNKELANVRYSLVFFPVSGGKETFTHVTNEKGRTKPIRLNQNGKLHIFVEGHET
IFSPRKIIKPVLAEDDSVIEINEPKLAQNSAFITQQQYELQQNSLQNLKQRTSVTKNKAGGFLNSSKIKP
AMMLDLKKKLKDNQAMSYEIYKEKNTILTKKTKYLKFKTYIMYRFVDSKGNGIPIIHYQILGQGQDRPII
NLKPAKVNEKGYTQLAETHLKTQVKYQLGNTQKESDWFEPITCIDKQTVHSIIFPMTTGVTNPNPENKLS
LKGVEKPPIVISPHTNEVLVLPPSVYAEFDRQTKILSDAVKKVHQSNAELTRAIQDRRLDEIKELESRLN
INQKKAIEKLNGEFKQSSELKEVWVVESTGKKNQSAPSYNLRRRYLKVTQYEELKRLRRNDQTTADIIDP
NATQYTPQRHAQIQSSFEKLSQQLLTAKGNVGSEEKAVYNMIGGLGGEIAEEYKNSRDIHVGTEAQWMRM
VAGSSGEGMISASSKGVTMKLDGNASTKWTLFEGVKEWRKFYPCESGWKIELENYDLGTIRFLIGAELAG
FSGANLGISGNLSVDITHNGTVQMLSAVIRDPQRSISQMMDPQRRPKFEPARGNMQMISANQENAKNQAN
AGIKAFAGVQVQGKLKGGIEWFKPNNDKSGEGEFVTIASVAGGGGVSLGAGAQGQFQIGYDERSGCFKIL
VAAHLCWGIGAKGIAEFTVGAEHVLNYLGFIKLQLLQANFRTLIYIQAQTFSLMSQVLAYCIGENHPLTQ
NVKNMTNQFNVWIESLDIDQGRLKTANNINSAKGREELIYATPETKGILLYAVTHWSSRTAPIFDIYVSF
SEREVRFFPARKTAVINILKTCVTTAEWQNTIQHIHPQGEKLNVSQFGKVEGDLIRFLNYGNNSKYAEDI
IRCVNSGIDYEGENINSWLKDYLKYRKGAKAVTGTSWNYMLVRNQDDKQFKQFELQQGMPVGFEERSLIA
QNLEILAPFEQDELNPTMHQA
-
Nucleotide Sequence: 3006 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c3043397-3040392 Acinetobacter sp. ADP1 chromosome, complete genome
ATGAATAAATATAACGTATTGGAATATAGTATTATTTTTTATGATCAGCGAAATAAAGAATTAGCAAATG
TTAGATATAGTCTTGTATTTTTTCCTGTTTCAGGTGGAAAAGAAACATTTACTCATGTCACAAATGAGAA
AGGACGAACAAAACCCATTCGATTGAACCAAAATGGAAAACTACATATTTTTGTAGAGGGGCATGAAACA
ATATTTAGTCCAAGGAAAATAATTAAGCCTGTTTTGGCAGAAGATGACAGTGTGATTGAAATTAATGAGC
CTAAGCTGGCTCAAAATTCAGCGTTTATTACCCAACAACAATATGAACTTCAGCAGAATAGTCTGCAAAA
TTTGAAGCAGCGTACATCAGTAACTAAAAATAAAGCAGGAGGCTTCCTAAATTCCTCTAAAATAAAGCCT
GCAATGATGTTAGATCTGAAGAAAAAACTAAAAGATAATCAGGCGATGTCTTATGAAATTTATAAGGAAA
AAAATACCATTCTTACTAAGAAAACTAAGTACTTAAAGTTTAAAACTTATATAATGTATCGATTCGTTGA
TAGTAAGGGAAATGGAATACCGATTATTCACTATCAAATATTAGGGCAAGGTCAAGATAGGCCTATTATA
AATTTGAAACCAGCTAAAGTGAATGAAAAAGGCTATACACAACTTGCAGAAACACATTTGAAAACGCAAG
TGAAATATCAACTAGGCAATACACAAAAAGAAAGTGACTGGTTTGAGCCGATTACATGTATTGATAAACA
AACTGTTCACTCCATTATTTTTCCAATGACAACAGGTGTAACTAATCCTAATCCTGAGAATAAATTAAGT
TTAAAAGGCGTAGAAAAACCACCTATTGTGATTAGTCCTCATACGAATGAGGTACTTGTTCTACCACCAA
GTGTGTATGCAGAGTTTGATCGACAGACAAAGATTTTATCTGATGCCGTGAAGAAAGTGCATCAATCAAA
TGCTGAGCTGACTCGAGCAATCCAAGATAGAAGATTAGATGAAATTAAAGAACTTGAAAGCAGATTGAAT
ATTAATCAAAAAAAAGCCATTGAAAAGCTTAATGGAGAATTCAAGCAATCAAGTGAGTTAAAAGAAGTAT
GGGTGGTAGAAAGTACTGGGAAGAAAAATCAAAGTGCTCCAAGTTATAATTTGAGAAGACGTTATCTTAA
AGTTACGCAATACGAAGAGCTTAAGCGCCTGCGTCGAAATGATCAAACAACAGCAGATATTATTGATCCG
AATGCAACTCAATATACTCCTCAACGTCATGCACAGATTCAAAGTAGTTTTGAAAAGCTCAGTCAACAGT
TATTGACTGCAAAAGGGAATGTAGGGAGTGAAGAAAAAGCTGTTTACAATATGATTGGCGGTTTAGGTGG
TGAAATTGCAGAAGAATATAAAAATAGCAGAGATATTCATGTGGGCACCGAAGCGCAATGGATGCGAATG
GTAGCAGGATCGAGTGGTGAAGGTATGATTAGTGCCTCTTCTAAAGGCGTCACCATGAAGCTTGATGGAA
ACGCATCGACTAAATGGACATTATTTGAAGGTGTAAAAGAGTGGCGAAAGTTTTATCCATGTGAATCTGG
GTGGAAAATTGAACTTGAAAACTATGATTTGGGTACGATTCGTTTCTTGATTGGTGCTGAACTGGCTGGA
TTCAGTGGAGCCAATTTAGGAATTTCAGGTAATTTATCTGTCGATATTACACATAATGGGACTGTACAGA
TGCTCAGTGCAGTGATTCGTGATCCACAACGTTCAATCTCACAAATGATGGATCCCCAAAGAAGACCTAA
GTTTGAACCTGCACGCGGTAACATGCAAATGATTAGTGCAAATCAGGAAAATGCTAAAAATCAAGCTAAT
GCAGGAATTAAGGCATTTGCTGGGGTGCAAGTGCAGGGAAAGCTCAAGGGAGGTATAGAATGGTTTAAGC
CCAATAATGATAAAAGTGGTGAAGGTGAGTTCGTTACAATTGCTTCAGTTGCTGGTGGTGGTGGTGTTAG
TTTGGGAGCGGGTGCTCAAGGTCAATTTCAAATTGGTTATGACGAGCGTTCTGGTTGCTTTAAGATTTTG
GTTGCAGCACATTTATGTTGGGGTATTGGTGCTAAAGGTATAGCAGAATTTACAGTAGGTGCAGAACATG
TTTTAAATTATTTAGGTTTTATTAAATTACAGTTATTACAAGCAAACTTCAGAACACTTATTTATATTCA
GGCTCAAACCTTTTCATTAATGTCTCAAGTTTTAGCTTATTGTATTGGTGAAAATCATCCATTAACACAA
AATGTGAAAAACATGACAAATCAATTCAATGTTTGGATTGAAAGTCTAGATATCGATCAAGGACGTTTAA
AAACAGCCAATAATATTAATTCAGCCAAAGGTCGTGAGGAATTAATTTACGCGACGCCAGAGACAAAAGG
TATTCTTTTATATGCAGTAACACATTGGTCTAGTCGTACAGCCCCAATTTTTGATATCTATGTGTCATTT
AGTGAGCGTGAAGTGCGGTTTTTTCCTGCACGTAAAACGGCGGTGATCAATATTCTAAAGACTTGTGTAA
CGACAGCAGAATGGCAAAATACCATTCAACATATTCACCCTCAAGGTGAAAAATTGAATGTTTCACAATT
TGGAAAAGTTGAAGGGGATCTGATTCGCTTTTTAAATTACGGCAATAATAGTAAATATGCAGAAGATATT
ATTCGTTGTGTCAATAGTGGTATTGATTATGAAGGAGAAAACATTAATTCATGGCTCAAAGATTATTTAA
AGTATCGTAAAGGTGCAAAAGCCGTCACCGGAACATCTTGGAATTATATGTTGGTTAGAAATCAGGATGA
TAAACAATTTAAACAGTTTGAGCTACAACAAGGGATGCCAGTTGGTTTTGAGGAGCGATCTTTGATAGCA
CAAAATTTAGAAATATTAGCACCATTTGAGCAGGATGAGTTAAATCCAACCATGCATCAGGCATAA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature