SecReT6
Effector Protein ID: 50086393
-
SecReT6 ID61
T6SS typeA4b
Gene symbol-
Locus tagACIAD3425
StrainAcinetobacter sp. ADP1
Repliconchromosome [GenBank: NC_005966] [Browse all T6SS(s) in this replicon]
Location [Strand]3339596..3341326 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorACIAD3425
DescriptionTle1 (ACIAD3425) was predicted tobe a phospholipase belonging to family 4 of T6SS-associated phospholipases (Russell et al., 2013). It matches an alpha/beta-hydrolase fold (Gene3D 3.40.50.1820) and the abhydrolase_5 domain (PF12695.5).
UniProt IDQ6F784
KEGG IDaci:ACIAD3425
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 576 a.a.     [Download]
>gi|50086393|ref|YP_047903.1| hypothetical protein ACIAD3425 [Acinetobacter sp. ADP1]
MANKTIAQTGSATSPTTNKSGTYVEVPLQDTIPIIFVPGIMGSNIFNTVLGKPVWMIGNGISGQVKTLTK
QMGKTPAELQTELDPLNTRVDTSGDIKVDRRLKLTEKTLRERYWGTVHWDSYGGILTYLQMVLNNVDLNE
KPIYTTGLGGGYAAVQQMKQQEAVYEWKSLLNQTESSKWFPQQSFVPINQQEIEHLKKFHFPVYAMGYNW
LQSSENGAALVAQKLDKIKQEYGARFHKFIIVTHSMGGLLTRRLVQLCSADIAGVVHGVMPAEGAAAAYR
RIVAGSGDVGALPAYVLGKNTEHVTAVLANAPGGLELLPTKAYNSGKPWLFLNGSGLINGKDLQKNVVSL
PKNDPYEEIYKADGVWWEMVKDELVDPAKLIKKDNPNQRAKDVYFKKIEKVKEFHSKITNKYHPCTYVNY
GDDSKHLSFGTLTWTLDRPLRGLTAEQMKRLPRATAKQIGTYRQKIVQEQMVKIKEGKGTDANNRDLALE
NDGIRYISLVNGNLGVFSISNQDAAGDGTVPHQSGSAPLKQSGVKQVFKMTGFDHQGSYNNTQVKRSVLY
SIVKIIKENNIQPKFR
-
Nucleotide Sequence: 1731 bp     [Download]
>gi|50083297|ref|NC_005966.1|:c3341326-3339596 Acinetobacter sp. ADP1 chromosome, complete genome
ATGGCGAACAAAACTATTGCACAAACAGGGTCAGCCACTAGTCCAACGACCAATAAGTCTGGAACTTATG
TAGAGGTGCCTTTACAGGACACAATCCCAATTATTTTTGTACCTGGAATTATGGGTTCAAATATTTTTAA
TACTGTTTTGGGTAAGCCAGTCTGGATGATTGGTAATGGTATTTCTGGTCAAGTTAAAACCTTAACCAAA
CAGATGGGAAAAACTCCTGCTGAGCTACAGACAGAGTTAGACCCTTTAAATACAAGAGTAGATACAAGTG
GTGATATAAAAGTTGACCGACGACTAAAACTTACCGAAAAAACACTGCGGGAACGTTATTGGGGAACTGT
ACATTGGGATAGTTATGGTGGAATTCTAACTTATTTGCAAATGGTATTAAATAACGTCGATTTAAATGAA
AAACCGATTTATACAACCGGCTTGGGAGGAGGATATGCTGCCGTTCAACAAATGAAACAGCAAGAGGCAG
TTTATGAGTGGAAAAGTTTACTGAATCAAACTGAATCCTCAAAATGGTTTCCACAACAATCATTTGTGCC
GATTAATCAACAAGAGATAGAACATCTTAAAAAATTCCATTTTCCCGTCTATGCGATGGGGTATAACTGG
CTACAGTCGAGTGAAAACGGTGCAGCGCTTGTTGCTCAAAAACTAGATAAAATAAAGCAAGAATATGGTG
CACGCTTTCATAAATTTATTATCGTAACTCACTCTATGGGTGGCCTTTTAACGCGTAGATTAGTTCAATT
GTGTAGTGCTGATATTGCAGGTGTGGTACATGGAGTAATGCCTGCTGAAGGCGCAGCAGCAGCTTATCGT
CGTATTGTGGCAGGCTCTGGTGATGTCGGTGCTTTGCCAGCCTATGTTCTTGGTAAAAATACTGAACATG
TGACTGCGGTACTTGCAAATGCGCCAGGTGGTTTAGAACTGTTACCAACCAAAGCTTATAACAGTGGAAA
GCCATGGTTATTCTTAAACGGCTCAGGATTAATAAATGGAAAAGACTTACAAAAGAACGTTGTATCTCTT
CCGAAAAATGATCCATATGAAGAGATTTATAAGGCCGATGGGGTTTGGTGGGAAATGGTTAAGGATGAAC
TAGTTGATCCTGCCAAGTTAATTAAGAAAGATAATCCTAATCAGAGAGCCAAAGATGTATATTTCAAAAA
AATTGAGAAAGTAAAAGAATTTCATTCTAAGATTACCAATAAATATCATCCATGTACTTATGTTAACTAT
GGAGATGACTCTAAACATTTAAGTTTTGGAACACTTACATGGACGTTAGATCGACCATTACGGGGATTAA
CTGCTGAACAAATGAAGAGGTTACCAAGAGCGACAGCAAAGCAAATAGGTACATATCGTCAAAAAATTGT
TCAAGAACAAATGGTCAAAATTAAAGAGGGCAAAGGTACAGATGCGAACAATCGTGACTTAGCACTTGAG
AATGATGGTATCCGCTATATCTCGTTAGTAAATGGTAATCTGGGTGTCTTTTCAATCTCCAATCAAGACG
CAGCTGGAGATGGTACCGTACCGCACCAGTCTGGTTCTGCTCCACTAAAACAGTCTGGCGTTAAACAAGT
ATTTAAAATGACAGGTTTTGATCATCAAGGGAGTTATAACAATACTCAAGTTAAACGCTCAGTCTTATAT
TCAATAGTAAAGATCATTAAAGAGAATAATATTCAGCCAAAATTTAGATGA

Reference
(1) Ringel PD, Hu D, Basler M (2017). The Role of Type VI Secretion System Effectors in Target Cell Lysis and Subsequent Horizontal Gene Transfer. Cell Rep. 21(13):3927-3940. [PudMed:29281838] experimental
 
experimental experimental literature