SecReT6
Effector Protein ID: 50119407
-
SecReT6 ID40
T6SS typeA1
Gene symbol-
Locus tagECA0456
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]520562..521041 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA0456
DescriptionHcp protein
UniProt IDQ6DA07
KEGG IDeca:ECA0456
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-29, Aligned region: 6..144
Protein Sequence: 159 a.a.     [Download]
>gi|50119407|ref|YP_048574.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MANSIFMKITGKIQGLISEGCLSIDSVGNKHISGHEDEIFVYATNYDLSRDRHVNHHPFSVTKAVDKSTP
LVLTSIANNELLEVELRYYRTSASGTQENYMTITLRDASIVNLSNQNPNSLTHNDMQPFETLSLRYESIT
CQHNIAGTSGYSILTENMY
-
Nucleotide Sequence: 480 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c521041-520562 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCTAATTCTATTTTTATGAAGATAACGGGTAAAATTCAGGGATTAATTTCTGAAGGATGTTTAAGTA
TCGACTCGGTAGGAAATAAACATATTTCTGGTCACGAAGATGAAATTTTTGTTTATGCGACAAATTACGA
TCTATCAAGAGATCGACACGTCAATCATCACCCCTTTTCCGTGACAAAAGCCGTTGATAAATCCACACCG
CTAGTCCTAACCAGCATCGCCAATAATGAACTATTAGAAGTTGAGTTGAGGTATTACCGCACTTCCGCCA
GCGGGACCCAAGAGAACTACATGACAATAACATTGAGGGATGCCTCTATTGTCAATCTTTCTAATCAAAA
TCCTAATTCATTGACGCATAACGATATGCAACCGTTTGAAACCCTAAGCCTGCGTTATGAAAGCATCACC
TGCCAACACAATATTGCCGGTACATCAGGGTACAGCATATTAACTGAAAACATGTACTGA

Reference
(1) Mattinen L et al. (2008). Microarray profiling of host-extract-induced genes and characterization of the type VI secretion cluster in the potato pathogen Pectobacterium atrosepticum. Microbiology. 154(Pt 8):2387-96. [PudMed:18667571]