SecReT6
Effector Protein ID: 50121032
-
SecReT6 ID40
T6SS typeA1
Gene symbol-
Locus tagECA2104
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]2390748..2392775 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorABG57133
Descriptiontype VI secretion system Vgr family protein
UniProt IDI1SBE4
KEGG IDeca:ECA2104
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-67, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.20E-21, Aligned region: 367..460
DUF2345 [PF10106], Evalue: 4.60E-05, Aligned region: 564..611
Protein Sequence: 675 a.a.     [Download]
>gi|50121032|ref|YP_050199.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MANSTGLQFTVKVGALAAGTFAVVDFRLDEGLNRPFSLSLSLASALPDVDFGAVLDQPCELMIWYEGELK
RRVCGIISGFTQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIISILLEETGITDYAFSLRHD
HTVREYCVQYRESDLAFLTRLTAEEGLYFFHEFEEGKHRVVFADDAGALTKGPELFFNLAVQGLSEGDYV
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSNELAHQRESYQHYDYPGRYKQEPSGKAFSGYRLDAL
RSGAVTGAGESNAAMLMPGSSFMLTEHPNPALNSGWQLVAITHSGQQPQALEEESGGEPTTYSNSFDVIS
ANTTWRAELPYKPMVDGPQIATVVGPAGEEIYCDQYGRVKLQFPWDRYGASNDQSSCWVRVSQGWAGGQY
GMIAIPRISHEVIVSFLEGDPDQPIITGRTFHATNRPPYDLPAHKTRTVLRTETHQGEGFNELRFEDQAG
QEEIYIHGQKDLNALIENDVVWHIKRDAHTDIDNDRVTRVKANDHLTVESEKRDHVKGDYSLNVDASMHQ
KLGQALLVEAGQEVHVKAGAKVVLEAGAELTLKVGGSFIKIDPSGVSVVGPAIKINSGGSAGSGSGWAGQ
SPILPGGVAVPPAPPATLPAPAIHKSMESMSPLVKPCPLAKGGKA
-
Nucleotide Sequence: 2028 bp     [Download]
>gi|50118965|ref|NC_004547.2|:2390748-2392775 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCAAACAGTACCGGATTGCAATTCACCGTAAAGGTCGGCGCGCTTGCGGCAGGCACGTTTGCGGTGG
TGGATTTCAGGCTGGATGAGGGGCTGAACCGGCCTTTCAGCCTGTCGCTGAGTCTGGCGAGCGCGTTGCC
GGATGTCGATTTTGGCGCGGTTCTGGACCAGCCGTGCGAACTGATGATTTGGTATGAGGGCGAGTTAAAA
CGCCGAGTCTGCGGGATTATTAGTGGATTCACGCAGGGTGACACCGGATTTCGCCGCACGCGCTATCAGG
CAGAAGTCAGGCCTGCCCTGTGGCGACTAGGGCTTCGCACCAATGCCCGTATCTTTCAGGCACAGAAACC
GGAAGCGATTATCAGCATATTGCTGGAAGAAACGGGTATCACCGATTATGCCTTTTCGCTGCGCCATGAC
CATACGGTGCGGGAATACTGCGTGCAGTACCGAGAAAGTGATTTGGCGTTTCTTACCCGGTTGACCGCAG
AGGAAGGCCTGTACTTCTTCCATGAGTTTGAGGAAGGCAAACACCGTGTGGTGTTTGCTGATGATGCCGG
GGCGCTGACCAAAGGCCCCGAGCTGTTCTTCAATCTGGCGGTTCAGGGGCTGAGCGAAGGCGACTATGTC
CGGCGGTTCCACTACGCGGAGCGGGTGAGTACGGCAGAAGTGGAATTGAAGGACTACAGCTTCAAAACCC
CGGCTTACGGGCTGTCACACAAGAAGATGAGCAACGAGCTGGCGCACCAGCGCGAAAGCTATCAGCACTA
CGATTATCCGGGGCGCTATAAACAAGAACCGAGCGGCAAGGCGTTCAGCGGTTACCGGCTGGATGCGCTA
CGTTCAGGGGCGGTGACCGGCGCGGGTGAATCGAATGCGGCGATGTTAATGCCGGGCAGCAGTTTCATGT
TGACCGAGCACCCCAATCCGGCGCTGAATAGCGGCTGGCAACTGGTGGCTATCACGCACAGTGGGCAGCA
ACCGCAGGCGCTGGAGGAGGAAAGTGGCGGCGAACCGACCACCTACAGTAACAGCTTCGACGTCATTAGC
GCCAACACGACTTGGCGTGCGGAGTTGCCATACAAACCGATGGTCGATGGCCCGCAAATCGCCACCGTCG
TCGGCCCGGCGGGAGAAGAGATTTACTGCGACCAGTACGGTCGGGTAAAACTGCAATTCCCGTGGGATCG
CTATGGCGCGAGCAACGACCAGAGCTCCTGTTGGGTGCGTGTCAGTCAGGGCTGGGCTGGCGGTCAGTAC
GGCATGATTGCTATCCCGCGCATCAGCCATGAAGTGATTGTTAGCTTCCTAGAAGGTGATCCCGACCAGC
CGATTATCACCGGGCGTACGTTCCACGCGACCAACCGTCCTCCTTACGACTTGCCTGCGCACAAGACGCG
CACCGTGCTGCGTACGGAAACCCATCAGGGCGAAGGATTTAATGAGCTGCGCTTTGAAGATCAGGCAGGG
CAGGAAGAGATTTATATTCATGGTCAGAAAGATCTCAACGCGCTGATTGAGAACGATGTTGTCTGGCATA
TCAAACGCGATGCACATACGGATATTGATAATGACCGTGTAACTCGCGTTAAAGCCAACGATCACCTGAC
GGTCGAGAGCGAGAAACGTGATCATGTTAAAGGGGATTACTCACTGAACGTCGATGCCTCTATGCACCAG
AAACTGGGACAGGCTTTGCTGGTCGAGGCAGGGCAAGAAGTGCATGTGAAAGCGGGGGCTAAGGTGGTTC
TTGAAGCGGGGGCGGAGCTGACGCTGAAAGTCGGGGGAAGCTTCATCAAGATCGATCCCAGCGGCGTGAG
CGTGGTGGGCCCGGCTATCAAAATTAACTCTGGGGGCAGTGCTGGGAGCGGTTCTGGTTGGGCAGGACAG
AGCCCCATTCTGCCGGGTGGTGTTGCCGTCCCACCTGCACCACCCGCGACATTGCCTGCCCCTGCCATTC
ATAAAAGCATGGAATCGATGTCACCGCTTGTCAAACCTTGTCCCCTCGCTAAGGGAGGCAAAGCATGA