SecReT6
Effector Protein ID: 50121791
vgrG
SecReT6 ID40
T6SS typeA1
Gene symbolvgrG
Locus tagECA2867
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3205452..3207311 [+]
ProductRHS accessory genetic element
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ6D377
KEGG IDeca:ECA2867
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-65, Aligned region: 40..338
Phage_base_V [PF04717], Evalue: 1.30E-22, Aligned region: 377..469
Gp5_C [PF06715], Evalue: 0.00061, Aligned region: 511..533
Gp5_C [PF06715], Evalue: 0.00061, Aligned region: 526..548
Gp5_C [PF06715], Evalue: 0.00061, Aligned region: 559..575
Protein Sequence: 619 a.a.     [Download]
>gi|50121791|ref|YP_050958.1| vgrG gene product [Pectobacterium atrosepticum SCRI1043]
MFITGREGINVANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLASALPDVDFGAVLDQPCE
LLVWYEGELKRRVSGIISAFAQGDTGFRRTRYQAEVRPALWRLGLRTNARLFQAQKPEAIIGTLLEESGI
TDYAFALRHDHAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALSKGPELFFNLA
NQGLSEGDYVRRFRYAEAVSTAEVALKDYSFKTPAYGLLHSKMSGELSHQRESYQHFGYPGRFKQDPSGK
AFTGYRLDALRANAMTGSGESNAAMLMPGNSFTLTEHPNPTLNSGWQLVAITHSGQQPQALEEESGGEPT
TYSNSFEVISAKSTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGSSDDQSSCWVR
VSQGWAGGQYGLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTSTHKGAGF
NELRFEDQAGQEEVFIHAQKDMNTVVLNNRSTTVTADHTESVGGNQAVSVVKDQSTEIQGQQSIAVTKNR
NTVVDDNDSLQVKNNIAIQSQKGDILIATDKGFIGIGADGVINIKGTHIVINGQQIDLN
-
Nucleotide Sequence: 1860 bp     [Download]
>gi|50118965|ref|NC_004547.2|:3205452-3207311 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
GTGTTCATCACGGGACGCGAGGGAATAAACGTGGCAAACAGTACAGGATTACAGTTCACGGTAAAGGTCG
GTGCATTGCCCGCCTCGACCTTTGCCGTGGTGGATTTTCAGCTCAGCGAGGCCCTTAACCAGCCATTTGC
CCTGTCACTGAATCTGGCGAGTGCCTTGCCGGATGTCGATTTTGGCGCCGTGCTCGACCAGCCGTGTGAG
CTGCTGGTGTGGTACGAAGGCGAACTGAAACGGCGCGTCAGCGGGATTATCAGCGCCTTCGCACAGGGCG
ACACCGGCTTTCGCCGCACACGCTATCAGGCAGAGGTTCGCCCGGCACTGTGGCGGCTGGGGCTGCGTAC
CAATGCCCGCCTCTTTCAGGCGCAAAAGCCGGAGGCCATTATCGGTACGTTGCTGGAAGAGTCTGGCATT
ACCGATTATGCCTTTGCATTACGTCACGACCACGCCCCGCGCGAATACTGCGTACAGTATCGTGAGAGTG
ATTTGGCGTTTGTCACCCGTCTGGCAGCGGAAGAAGGGCTGTACTTCTTCCATGAGTTTGAAGAAGGCAA
GCATCGCGTCGTCTTTGCGGATGATGCCGGGGCGCTCAGCAAAGGCCCCGAACTGTTCTTCAACCTCGCC
AATCAGGGACTGAGCGAAGGCGACTATGTCCGCCGCTTCCGCTACGCCGAAGCCGTGAGTACCGCCGAGG
TCGCCCTCAAGGATTACAGCTTCAAAACCCCGGCCTATGGCCTGCTGCACAGCAAGATGAGTGGCGAACT
GTCACACCAGCGCGAAAGCTATCAGCACTTCGGCTACCCCGGCCGCTTCAAGCAAGACCCGAGCGGCAAG
GCCTTTACCGGCTACCGGCTGGATGCGTTACGCGCGAATGCGATGACCGGCTCGGGTGAATCCAATGCCG
CCATGCTGATGCCCGGCAACAGTTTTACCTTAACCGAACATCCTAATCCGACGCTGAATAGTGGCTGGCA
ACTGGTTGCCATCACGCACAGCGGGCAGCAACCGCAGGCACTGGAAGAAGAAAGTGGCGGTGAACCGACC
ACCTACAGCAACAGCTTCGAGGTCATCAGCGCCAAAAGCACCTGGCGTGCCGACCTGCCGTACAAGCCGA
TGGTGGATGGTCCGCAGATTGCCACCGTGGTGGGCCCCGCTGGTGAGGAAATCTACTGTGACGAATATGG
CCGCATCAAATTGCAATTCCCGTGGGACAGATACGGCTCCAGTGACGACCAGAGTTCCTGCTGGGTGCGC
GTCAGTCAGGGCTGGGCGGGCGGCCAATATGGCCTGATAGCCATCCCACGCATCGGCCATGAGGTCATTG
TCAGTTTCCTTGAAGGCGACCCGGACCAGCCGATTGTCACCGGACGCACCTTTCATGCCACTAACCCGTC
GCCGTACCCGCTACCGGCGAACAAGACCCGCACCTCGCTGCGTACCTCGACGCATAAAGGGGCCGGGTTC
AACGAACTGCGCTTTGAAGACCAGGCCGGGCAGGAAGAGGTATTTATCCATGCCCAGAAGGACATGAACA
CCGTGGTGTTGAATAACCGTAGTACGACTGTGACCGCTGACCACACCGAAAGCGTCGGTGGCAATCAGGC
AGTCTCGGTAGTGAAAGACCAGTCTACTGAAATCCAGGGGCAGCAGAGTATCGCCGTGACCAAAAACCGT
AACACGGTCGTGGATGACAACGACAGCCTGCAGGTGAAAAACAACATCGCTATCCAGTCGCAGAAGGGGG
ACATCCTGATAGCGACTGACAAGGGGTTTATTGGTATCGGTGCTGACGGGGTTATCAATATCAAGGGTAC
CCACATTGTCATCAACGGCCAGCAAATCGACCTGAACTGA