SecReT6
Effector Protein ID: 50122352
SecReT6 ID40
T6SS typeA1
Gene symbol-
Locus tagECA3428
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]3841279..3841797 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA3428
DescriptionHcp protein
UniProt IDQ6D1L7
KEGG IDeca:ECA3428
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-34, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|50122352|ref|YP_051519.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSTGEMLPTTTLKWYRTSVEGKQEHFFSTILTDATIVDIDCKMPHCQDPSKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRTPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|50118965|ref|NC_004547.2|:c3841797-3841279 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGGAAAACTCAGGGCAACATCACCGCCGGTGCCTTCACGT
CTGATTCTGTCGGCAACATCTATGTCGAAGGCCACGAAGACGAAATGCTGGTGCAGGAATTCAAACACGT
GGTTACCGTGCCGACCGACCCGCAGTCTGGTCAGCCGTCCGGCCAACGCGTGCACAAGCCGTTTAAATTC
ACCGTCGCGCTGAACAAAGCTGTTCCACTGCTGTACAACGCACTGTCTACCGGTGAAATGCTGCCAACTA
CGACCCTGAAGTGGTATCGCACCTCGGTGGAAGGCAAGCAGGAGCACTTCTTCTCTACCATCCTTACCGA
TGCCACCATCGTGGATATCGACTGCAAAATGCCACACTGCCAGGACCCGTCCAAACTGGATTACACCCAA
CTGATTGAAGTGTCGCTGGCTTACCGCAAAATCGACTGGGAACACACGGTTGCAGGGACTTCTGGCTCTG
ATGACTGGCGTACGCCGGTCGAAGCGTAA

Reference
(1) Mattinen L et al. (2008). Microarray profiling of host-extract-induced genes and characterization of the type VI secretion cluster in the potato pathogen Pectobacterium atrosepticum. Microbiology. 154(Pt 8):2387-96. [PudMed:18667571]