SecReT6
Effector Protein ID: 50123062
SecReT6 ID40
T6SS typeA1
Gene symbol-
Locus tagECA4142
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]4624416..4626443 [+]
ProductRHS accessory genetic element
Effector typeProtein
Homologous effectorABG57133
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ6CZK9
KEGG IDeca:ECA4142
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-69, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.40E-21, Aligned region: 367..460
DUF2345 [PF10106], Evalue: 2.00E-05, Aligned region: 565..611
Protein Sequence: 675 a.a.     [Download]
>gi|50123062|ref|YP_052229.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MANSTGLQFTVKVGALEAGTFAVVDFRLDEGLNCPFSLSLSLASALPDVDFGAVLDQPCELMIWYEGELK
RRVSGIISGFTQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGALLEEAGVTDYAFALRHE
HAVREYCVQYRESDLAFITRLAAEEGLYFFHEFEEGKHRVVFADDAGALTKGPKLFFNLATQGLSEGEYV
RRFHYAERVSTAEVELKDYNFKTPAYGLSHKKMSGELAHQRESYQHYDYPGRYKQDPSGKAFSGYRLDAL
RSGAVTSEGESNCAGLMPGNTFTLTEHPNATLNAVWQTASVTHVGQQPQALEEESGGEPTTISNSFAVVK
GTTTWRAAMPYKPMVDGPQIATVVGPAGEEIYCDPYGRVKLQFPWDRYGASNDQSSCWVRVSQGWAGGQY
GMIAIPRISHEVIVSFLEGDPDQPIITGRTFHATNRPPYDLPAHNTRTVLRTETHQGEGFNELRFEDQAG
QEEIYIHGQKDLNGLIENDVVWHIKHDAHTDIDNERVTRIKANDHLTVENEKRDHVKGDYSLSVDASMHQ
KLGQALLVEAGQEVHLTSGNKIVLEAGAELTLKVGGSFVKIDPSGVTLVGPSIKMNSGGSPGFGSGWAGQ
MPTFPGAVEVVKAPQPPQVPPLEKPVCIPCLLRAMAQGDALVQGE
-
Nucleotide Sequence: 2028 bp     [Download]
>gi|50118965|ref|NC_004547.2|:4624416-4626443 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCAAACAGTACAGGATTACAGTTCACCGTAAAGGTTGGCGCTCTGGAGGCTGGCACTTTTGCGGTGG
TGGACTTCAGGCTGGATGAGGGGTTGAATTGCCCCTTCAGCCTGTCGCTGAGTCTGGCGAGCGCGTTGCC
GGATGTGGATTTTGGTGCGGTGCTGGACCAGCCGTGCGAGCTGATGATTTGGTATGAGGGCGAGTTAAAA
CGCCGAGTCAGCGGGATTATTAGTGGATTCACGCAGGGTGACACCGGATTTCGGCGCACGCGCTATCAGG
CGGAAGTCCGTCCGGCGCTGTGGCGACTGGGTCTGCGCACCAACGCCCGCATCTTTCAGGCGCAGAAGCC
GGAAGCGATTATCGGTGCATTGCTGGAAGAAGCAGGCGTTACCGACTACGCCTTTGCGCTGCGCCATGAG
CACGCGGTGCGGGAATACTGCGTACAGTATCGGGAAAGTGATTTAGCGTTTATCACCCGACTGGCGGCGG
AGGAAGGTCTGTACTTCTTCCACGAGTTCGAGGAAGGCAAGCATCGGGTCGTGTTTGCCGATGATGCGGG
GGCGCTGACCAAAGGGCCTAAGCTGTTCTTCAATCTGGCGACACAGGGGTTAAGTGAGGGCGAATATGTC
CGGCGTTTCCACTACGCGGAGCGAGTGAGCACGGCCGAAGTGGAACTGAAGGACTACAACTTCAAGACGC
CGGCTTACGGGCTGTCACACAAGAAGATGAGCGGTGAGCTGGCGCACCAACGTGAAAGTTATCAGCATTA
CGACTATCCGGGGCGCTATAAACAAGACCCGAGCGGCAAGGCGTTCAGCGGTTACCGGCTGGATGCGCTG
CGGTCAGGGGCGGTGACAAGCGAAGGGGAATCCAACTGCGCGGGGCTGATGCCGGGCAATACCTTTACCC
TGACGGAGCACCCGAATGCGACGCTGAACGCGGTGTGGCAGACGGCGAGCGTGACGCACGTCGGGCAGCA
GCCGCAGGCGCTGGAAGAGGAAAGCGGCGGCGAACCGACAACCATAAGCAACAGTTTTGCGGTGGTGAAG
GGCACAACGACGTGGCGCGCTGCGATGCCGTACAAACCGATGGTGGACGGCCCGCAAATCGCGACGGTGG
TCGGTCCGGCGGGTGAAGAGATTTACTGCGACCCGTACGGTCGGGTAAAACTGCAATTCCCGTGGGATCG
CTATGGCGCGAGCAACGACCAAAGCTCTTGCTGGGTGCGCGTCAGTCAGGGCTGGGCGGGTGGCCAATAC
GGCATGATCGCTATCCCACGCATCAGCCATGAAGTGATTGTCAGCTTCCTCGAAGGTGACCCAGACCAGC
CGATTATCACCGGGCGTACGTTCCACGCGACCAACCGTCCTCCTTACGACCTGCCTGCGCACAATACGCG
TACCGTGCTACGCACGGAAACTCATCAGGGTGAAGGATTCAATGAGCTGCGCTTTGAAGATCAGGCCGGG
CAGGAAGAAATTTATATTCACGGGCAGAAAGACCTGAACGGCCTGATTGAGAACGATGTTGTCTGGCACA
TCAAACATGATGCCCACACGGATATTGATAATGAGCGGGTAACGCGAATCAAAGCCAACGATCACCTGAC
GGTCGAGAACGAGAAACGTGATCATGTTAAAGGGGATTACTCACTGAGCGTCGATGCCTCGATGCACCAG
AAACTGGGGCAGGCTTTGCTGGTTGAGGCCGGACAAGAGGTTCATCTTACATCTGGCAACAAGATAGTGC
TGGAAGCCGGGGCTGAACTGACGCTCAAAGTGGGTGGCAGCTTCGTGAAGATTGATCCCAGTGGCGTGAC
GCTGGTTGGCCCCAGCATCAAGATGAATTCAGGCGGCAGCCCCGGTTTTGGTTCTGGCTGGGCAGGTCAA
ATGCCCACCTTTCCGGGGGCGGTTGAGGTGGTTAAAGCGCCCCAACCGCCACAGGTGCCACCTCTTGAAA
AACCAGTCTGTATTCCCTGTCTGCTACGCGCCATGGCGCAGGGCGATGCGTTGGTTCAGGGAGAATAA